Primary Information |
---|
BoMiProt ID | Bomi3844 |
---|
Protein Name | Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q08E15 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001001151.2 |
---|
Aminoacid Length | 332 |
---|
Molecular Weight | 38034 |
---|
FASTA Sequence |
Download |
---|
Gene Name | ST6GALNAC6 |
---|
Gene ID | 407222 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | Catalyzes the transfer of N-acetylneuraminyl groups onto glycan chains in glycoproteins. |
---|
Biochemical Properties | the substrate speci¢city of cST6GalNAc I is almost the same as that of mouse, and also cST6GalNAc II exhibits similar substrate speci¢city to the mouse enzyme. |
---|
PTMs | Glycosylation at Asn |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q08E15|SIA7F_BOVIN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 OS=Bos taurus OX=9913 GN=ST6GALNAC6 PE=2 SV=1
MACPRPLSQCDHTPLPGPPAGHWPLPLSRRRREMKSNKEQRSAVFVILFALITILILYSS
SSANEVFHYGSLRGRTRRPVNLRKWSITDGYIPILGN*97KTLPSRCGQCVIVTSSSHLLGTK
LGPEIERAECTIRMNDAPTTGYSADVGNKTTFRVVAHSSVFHVLRRPQEFVNRTPETVFI
FWGPPNKMQKPQGSLVRVIQRAGLVFPNMEAYAISLSRMRQFDDLFRSETGKDREKSHSW
LSTGWFTMVIAVELCDHVHVYGMVPPDYCSLRPHLQRMPYHYYEPKGPDECVTYIQNENS
RKGNHHRFITEKRVFSSWAQLYGITFSHPSWT
|
---|
Predicted Disorder Regions | (1-35) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | 1TMH; (42-60) |
---|
Additional Comments | Genetic interactions of C1GALT1 and ST6GALNAC2 variants influence IgA1 O-glycosylation, disease predisposition, and disease severity, and may contribute to the polygenic nature of IgAN. |
---|
Bibliography | 1.Samyn-Petit B, Krzewinski-Recchi MA, Steelant WF, Delannoy P, Harduin-Lepers A. Molecular cloning and functional expression of human ST6GalNAc II. Molecular expression in various human cultured cells. Biochim Biophys Acta. 2000 Apr 6;1474(2):201-11. doi: 10.1016/s0304-4165(00)00020-9. PMID: 10742600. |