Primary Information |
---|
BoMiProt ID | Bomi3843 |
---|
Protein Name | Alpha-N-acetylgalactosaminidase/Alpha-galactosidase B |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q58DH9 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001039814.1 |
---|
Aminoacid Length | 411 |
---|
Molecular Weight | 46533 |
---|
FASTA Sequence |
Download |
---|
Gene Name | NAGA |
---|
Gene ID | 533357 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | Enzymatical conversion of A RBCs into group O RBCs (ECORBCs) was achieved by using α-N-acetylgalactosaminidase. |
---|
Biochemical Properties | The marine invertebrate starfish was found to contain α-N-acetylgalactosaminidase, α-GalNAcase II, which catalyzes removal of terminal α-N-acetylgalactosamine (α-GalNAc), in addition to a typical α-N-acetylgalactosaminidase, α-GalNAcase I, which catalyzes removal of terminal α-N-acetylgalactosamine (α-GalNAc) and, to a lesser extent, galactose. |
---|
PTMs | Disulfide bond formation,N-linked Glycosylation at Asn, Phosphorylation at Ser |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q58DH9|NAGAB_BOVIN Alpha-N-acetylgalactosaminidase OS=Bos taurus OX=9913 GN=NAGA PE=2 SV=1
MLLKTVLLLALASQVLVLENGLLRKPPMGWLAWERFRCNIDCSEDPKNCISEQLFMEMAD
RLAQDGWRDLGYVYLNIDDCWIGGRDAKGNLVPDRKRFPHGIAFLADYAHSLGLKLGIYE
DLGN*124FTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCYSTPQERAEGYPKMAAALN*177ATG
RPIAFSCSWPAYEGGLPPKVN*201YTLLADICNLWRNFDDIQDSWRSVLSVLDWFVTHQDVLQ
PIAGPGHWNDPDMLLIGNFGLSFEQAQAQMALWTVLAAPLFMSTDLRTISAQNMDILQNP
LMIKINQDPLGIQGRRILKEKS*322HIEVYLRPLASEASAIVFFSRRMDMPYHYHSSLARLN*359F
SSSVVYEAQDVYTGDIISGLQDKTN*385FTVIINPSGVVMWYLYPIRKLEIPQQ
|
---|
Predicted Disorder Regions | NA |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | α-N-acetylgalactosaminidase (nagalase) facilitates the deglycosylation of Gc-MAF, which in turn inhibits the activation of macrophages. |
---|
Bibliography | 1.Rashid MH, Sadik G, Alam AK, Tanaka T. Chemical and structural characterization of α-N-acetylgalactosaminidase I and II from starfish, asterina amurensis. BMC Biochem. 2017 May 25;18(1):9. doi: 10.1186/s12858-017-0085-1. PMID: 28545388; PMCID: PMC5445309. 2.Saburi E, Tavakol-Afshari J, Biglari S, Mortazavi Y. Is α-N-acetylgalactosaminidase the key to curing cancer? A mini-review and hypothesis. J BUON. 2017 Nov-Dec;22(6):1372-1377. PMID: 29332325. 3.Gao H, Li S, Tan Y, Ji S, Wang Y, Bao G, Xu L, Gong F. Application of α-N-acetylgalactosaminidase and α-galactosidase in AB to O red blood cells conversion. Artif Cells Nanomed Biotechnol. 2013 Feb;41(1):32-6. doi: 10.3109/10731199.2012.724422. Epub 2012 Oct 2. PMID: 23030311. |