Primary Information |
---|
BoMiProt ID | Bomi3804 |
---|
Protein Name | Allograft inflammatory factor 1 |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q9BDK2 |
---|
Milk Fraction | Exosomes |
---|
Ref Sequence ID | NP_776410.1 |
---|
Aminoacid Length | 147 |
---|
Molecular Weight | 16855 |
---|
FASTA Sequence |
Download |
---|
Gene Name | AIF1 |
---|
Gene ID | 280989 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Presence in other biological fluids/tissue/cells | spleen |
---|
Protein Function | Allograft inflammatory factor-1 (AIF-1) is a 17 kDa calcium-binding protein produced by monocytes, macrophages, and lymphocytes; its synthesis is induced by INF-γ. |
---|
PTMs | Phosphorylation at Serine,N-acetylation at Serine |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q9BDK2|AIF1_BOVIN Allograft inflammatory factor 1 OS=Bos taurus OX=9913 GN=AIF1 PE=2 SV=1
MSETRDLQGGKAFGLRKAQQEERINEINQQFLDDPKYSS*39DEDLPSKLEAFKKKYMEFDLN
EDGGIDIMSLKRMMEKLGVPKTHLELKKLIMEVSSGPGETFSYSDFLKMMLGKRSAILKM
ILMYEEKAREQEKPTGLPAKKAISELP
|
---|
Predicted Disorder Regions | 1-45, 80-82, 114-119, 132-147 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | Overexpression of AIF-1 causes enhanced production of cell cycle proteins and G-CSF, both of which are responsible for the proliferation of VSMCs.Site-directed mutagenesis in the EF region of AIF-1 causes
loss of its calcium-binding activity, which makes AIF-1 incapable of enhancing proliferation,migration, and G-CSF expression. |
---|
Bibliography | 1.Sikora M, Kopeć B, Piotrowska K, Pawlik A. Role of allograft inflammatory factor-1 in pathogenesis of diseases. Immunol Lett. 2020 Feb;218:1-4. doi: 10.1016/j.imlet.2019.12.002. Epub 2019 Dec 9. PMID: 31830499. 2.Autieri MV, Kelemen SE, Wendt KW. AIF-1 is an actin –polimerizing and Rac1-activating protein that promotes vascular smooth muscle cell migration. Circ Res 2003;92:1107-1114. |