Primary Information |
|---|
| BoMiProt ID | Bomi3759 |
|---|
| Protein Name | Advanced glycosylation end product-specific receptor |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q28173 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_776407.1 |
|---|
| Aminoacid Length | 416 |
|---|
| Molecular Weight | 44182 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | AGER |
|---|
| Gene ID | 280986 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | cell surface receptor for advanced glycation end-products (RAGE). involved in inflammatory and immune responses . |
|---|
| Biochemical Properties | Its 5 flanking region from -505 overlaps with the PBX2 gene.The protein exhibits only one transmembrane domain (343-363 AA) and has a short highly charged cytosolic tail (364-404 AA) that is critical to intracellular signaling. The V domain and its closest C domain have a high content of arginine and lysine residues carrying a positive charge; the second C domain has mainly acidic residues and is charged negatively. These three distinct domains explain how RAGE can be a multiligand receptor, with the ability to assemble as a multimer depending on the ligand. |
|---|
| PTMs | N-linked Glycosylation on asparagine |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q28173|RAGE_BOVIN Advanced glycosylation end product-specific receptor OS=Bos taurus OX=9913 GN=AGER PE=1 SV=1
MAAGAVVGAWMLVLSLGGTVTGDQN*25ITARIGKPLVLNCKGAPKKPPQQLEWKLNTGRTEA
WKVLSPQGDPWDSVARVLPN*80GSLLLPAVGIQDEGTFRCRATSRSGKETKSNYRVRVYQIP
GKPEIVDPASELMAGVPNKVGTCVSEGGYPAGTLNWLLDGKTLIPDGKGVSVKEETKRHP
KTGLFTLHSELMVTPARGGALHPTFSCSFTPGLPRRRALHTAPIQLRVWSEHRGGEGPNV
DAVPLKEVQLVVEPEGGAVAPGGTVTLTCEAPAQPPPQIHWIKDGRPLPLPPGPMLLLPE
VGPEDQGTYSCVATHPSHGPQESRAVSVTIIETGEEGTTAGSVEGPGLETLALTLGILGG
LGTVALLIGVIVWHRRRQRKGQERKVPENQEEEEEERAELNQPEEPEAAESSTGGP
|
|---|
| Predicted Disorder Regions | 3 disordered segments; (236-244), (317-347), (378-415) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 1TMH ; (351-373) |
|---|
| Bibliography | Serveaux-Dancer M, Jabaudon M, Creveaux I, Belville C, Blondonnet R, Gross C, Constantin JM, Blanchon L, Sapin V. Pathological Implications of Receptor for Advanced Glycation End-Product (AGER) Gene Polymorphism. Dis Markers. 2019 Feb 4;2019:2067353. doi: 10.1155/2019/2067353. PMID: 30863465; PMCID: PMC6378764. |
|---|
