Search by BoMiProt ID - Bomi3731


Primary Information

BoMiProt ID Bomi3731
Protein Name ADP/ATP translocase 1/ADP,ATP carrier protein 1/Adenine nucleotide translocator 1/Solute carrier family 25 member 4
Organism Bos taurus
Uniprot IDP02722
Milk FractionWhey
Ref Sequence ID NP_777083.1
Aminoacid Length 298
Molecular Weight 32967
FASTA Sequence Download
Gene Name SLC25A4
Gene ID 282478
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells heart, skeletal muscle, brain
Protein Function  The mitochondrial ADP/ATP carrier (Adenine Nucleotide Carrier or Ancp or ANC) is a nuclear encoded protein, which catalyzes the exchange of ATP4− generated in mitochondria by the ATP synthase with ADP3 produced in the cytosol by most of the energy-consuming reactions. 
PTMs Acetylation, Methylation, Phosphorylation at Serine, S-nitrosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P02722|ADT1_BOVIN ADP/ATP translocase 1 OS=Bos taurus OX=9913 GN=SLC25A4 PE=1 SV=3 MSDQALS*7FLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVR IPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASG GAAGATSLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCITKIFKSDGLRGLYQGFNVS VQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMM QSGRKGADIMYTGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIKKFV
SCOP Class : All alpha proteins
Fold : Mitochondrial carrier
Superfamily : Mitochondrial carrier
Family : Mitochondrial carrier
Domain Name : 1OKC A:2-293

CATH Matched CATH superfamily
1.50.40.10
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 2TMHs; (112-134),(209-231)
Significance of PTMs The phosphorylation of Tyr194 by the kinase Src would be essential to the ADP/ATP transport by ANC1.
PDB ID 1OKC, 2C3E,
Bibliography 1.Clémençon B, Babot M, Trézéguet V. The mitochondrial ADP/ATP carrier (SLC25 family): pathological implications of its dysfunction. Mol Aspects Med. 2013 Apr-Jun;34(2-3):485-93. doi:10.1016/j.mam.2012.05.006. PMID: 23506884. 2.J. Feng, E. Lucchinetti, G. Enkavi, Y. Wang, P. Gehrig, B. Roschitzki, M.C. Schaub, E. Tajkhorshid, K. Zaugg, M. Zaugg.Tyrosine phosphorylation by Src within the cavity of the adenine nucleotide translocase 1 regulates ADP/ATP exchange in mitochondria.Am. J. Physiol. Cell. Physiol., 298 (2010), pp. 740-748.