Primary Information |
|---|
| BoMiProt ID | Bomi3648 |
|---|
| Protein Name | Acyl-CoA-binding domain-containing protein 6 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A2VDR2 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001077252.1 |
|---|
| Aminoacid Length | 282 |
|---|
| Molecular Weight | 31275 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | ACBD6 |
|---|
| Gene ID | 618245 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | |
|---|
| Protein Function | function in hematopoiesis and development of vascular endothelium.ACBD6 binds acyl-CoAs of a chain length of 6 to 20 carbons.ACBD6 negatively affected the formation of phosphatidylcholine (PC) and phosphatidylethanolamine in the red blood cell membrane. |
|---|
| Biochemical Properties | ACBD6 bound all 3 acyl-CoA substrates , binding to unsaturated C18:1-CoA and C20:4-CoA with relatively high affinity and to the shorter and saturated C16:0-CoA with lower affinity. With C18:1-CoA as ligand, titration curves revealed 2 different binding constants, suggesting that ligand binding to the low-affinity site(s) occurred only after saturation of the high-affinity site(s). The stoichiometry of acyl-CoA binding suggested that ACBD6 functioned as a monomer and bound a total of 4 ligand molecules. Deletion of the C-terminal ankyrin motifs did not affect ligand binding by ACBD6. |
|---|
| PTMs | Phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A2VDR2|ACBD6_BOVIN Acyl-CoA-binding domain-containing protein 6 OS=Bos taurus OX=9913 GN=ACBD6 PE=2 SV=1
MASSFLPSGATTGDSGGELSSGDDSGDVESLQSPKIEASRS*41LPELFEKAAEHLQGLVQVA
SREQLLYLYARYKQVKVGNCNTPKPSFFDFEGKQKWEAWKALGDSS*106PSQAMQEYIAVVKK
LDPSWNPQSPEKKGKEANTGFGGPVVSSLYHEEIIREEDKDIFDYCRENNIDHITKVIKT
KNMDVNMKDEEGRTLLHWACDRGHKELVTVLLQYRADINCQDNEGQTALHYAAACEFLDI
VELLLQSGADPTLRDQDGCLPEEVTGCKAVTLMLQQHTTGKA
|
|---|
| Predicted Disorder Regions | 2 disordered segments; (1-42), (130-141) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | no TM helices |
|---|
| Bibliography | Soupene E, Serikov V, Kuypers FA. Characterization of an acyl-coenzyme A binding protein predominantly expressed in human primitive progenitor cells. J Lipid Res. 2008 May;49(5):1103-12. doi: 10.1194/jlr.M800007-JLR200. Epub 2008 Feb 11. PMID: 18268358; PMCID: PMC2311440. |
|---|
