Primary Information |
|---|
| BoMiProt ID | Bomi3556 |
|---|
| Protein Name | 60S ribosomal protein L30 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3T0D5 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001029606.1 |
|---|
| Aminoacid Length | 115 |
|---|
| Molecular Weight | 12784 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | RPL30 |
|---|
| Gene ID | 513031 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Formation of a pool of free 40S subunits.SRP-dependent cotranslational protein targeting to membrane. |
|---|
| Significance in milk | regulation of milk protein synthesis |
|---|
| PTMs | N6-acetyllysine , Phosphorylation on Ser,Glycyl lysine isopeptide (Lys-Gly) |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3T0D5|RL30_BOVIN 60S ribosomal protein L30 OS=Bos taurus OX=9913 GN=RPL30 PE=3 SV=3
MVAAKKTKKS*10LESINS*16RLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEI
EYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGEK
|
|---|
| Predicted Disorder Regions | 3 disordered segments; (1-19), (25-38), (105-115) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
