Primary Information |
|---|
| BoMiProt ID | Bomi3542 |
|---|
| Protein Name | 60S acidic ribosomal protein P0 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q95140 |
|---|
| Milk Fraction | Whey,exosome |
|---|
| Ref Sequence ID | NP_001012700.1 |
|---|
| Aminoacid Length | 318 |
|---|
| Molecular Weight | 34371 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | RPLP0 |
|---|
| Gene ID | 86868 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | a ribosomal protein, can interact with PLAAT4 and involved in PLAAT4-mediated growth inhibition and cellular apoptosis. |
|---|
| PTMs | Isopeptide bond formation, Phosphorylation, Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q95140|RLA0_BOVIN 60S acidic ribosomal protein P0 OS=Bos taurus OX=9913 GN=RPLP0 PE=2 SV=3
MPREDRATWKSNYFLKIIQLLDDY*24PKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNT*59M
MRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCE
VTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNI
SPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHS
IINGYKRVLALSVETDYTFPLAEKVKAFLADPSAFVAAAPVAAAPAAAPAATTAAPAKVE
AKEES*305EES*308DEDMGFGLFD
|
|---|
| Predicted Disorder Regions | 2 disordered segments; (1-5), (284-318) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | In Arabidopsis phosphorylation of Ser-103 in the 60S acidic ribosomal protein P1 (isoforms P1-1, P1-2, P1-3) and of Ser-305 in the 60S acidic ribosomal protein P0-2 had been detected |
|---|
| Bibliography | 1.Turkina, M. V., Klang Årstrand, H., & Vener, A. V. (2011). Differential phosphorylation of ribosomal proteins in Arabidopsis thaliana plants during day and night. PloS one, 6(12), e29307. https://doi.org/10.1371/journal.pone.0029307 2.Wang CH, Wang LK, Wu CC, Chen ML, Lee MC, Lin YY, Tsai FM. The Ribosomal Protein RPLP0 Mediates PLAAT4-induced Cell Cycle Arrest and Cell Apoptosis. Cell Biochem Biophys. 2019 Sep;77(3):253-260. doi: 10.1007/s12013-019-00876-3. Epub 2019 May 26. PMID: 31131438. |
|---|
