Primary Information |
|---|
| BoMiProt ID | Bomi3532 |
|---|
| Protein Name | 5,6-dihydroxyindole-2-carboxylic acid oxidase/Tyrosinase-related protein 1/TRP-1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q8WN57 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_776905.2 |
|---|
| Aminoacid Length | 537 |
|---|
| Molecular Weight | 60617 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | TYRP1 |
|---|
| Gene ID | 282105 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | At low concentration, DHICA acts as a cofactor for their tyrosine hydroxylase activities, whereas at higher concentrations, it inhibits tyrosine hydroxylation. |
|---|
| Biochemical Properties | Tyrosinase and tyrosinase-related protein 1 (TRP-1) share a significant level of homology in several regions including the catalytic domain and the potential N-glycosylation sites. |
|---|
| PTMs | N-linked Glycosylation at Asn |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q8WN57|TYRP1_BOVIN 5,6-dihydroxyindole-2-carboxylic acid oxidase OS=Bos taurus OX=9913 GN=TYRP1 PE=2 SV=2
MKSPTLLSLGYMFLVLLFFQQAWAQFPRECATIEALRNGVCCPDLSPLSGPGSDRCGLSS
GRGRCEVVIADSRPHSHHYPHDGRDDREGWPTRSFN*96RTCHCNGN*104FSGHNCGTCRPGWGGA
ACDQRVLTVRRNLLDLSTEEKNRFVRALDMAKRTTHPQFVIATRRSEEILGPDGNTPQFE
N*181ISIYNYFVWTHYYSVKKTFLGAGQESFGEVDFSHEGPAFLTWHRYHLLQLERDMQEMLQ
DPSFSLPYWNFATGKNTCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCESLEDYDTLG
TLCN*304STEGGPIKRNPAGNVARPMVQRLPKPQDVAQCLEVGSYDTPPFYSN*350STNSFRNTVE
GYSHPTGRYDPAVRSLHNLAHLFLN*385GTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNA
DISTYPLENAPIGHNRQYNMVPFWPPVTNIEMFVTAPDNLGYTYEVQWPSRSFSISEIVT
IAVVAALSLVAVIFAGASCLIRARSNMDEANQPLLTDQYQHYIEEYEKIHNPNQSVV
|
|---|
| Predicted Disorder Regions | 78-83, 360-369, 526-537 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 2TMHs; (7-25), (479-501) |
|---|
| Significance of PTMs | It has been clearly established that N-glycosylation is essential for the correct folding of tyrosinase related protein 1. |
|---|
| Additional Comments | In mouse melanocytes, DHICA is formed by the dopachrome tautomerase-catalysed tautomerization of dopachrome, and its incorporation into melanin is accounted for by oxidation to the corresponding and unstable quinone by tyrp1. |
|---|
| Bibliography | 1.Olivares C, Jiménez-Cervantes C, Lozano JA, Solano F, García-Borrón JC. The 5,6-dihydroxyindole-2-carboxylic acid (DHICA) oxidase activity of human tyrosinase. Biochem J. 2001 Feb 15;354(Pt 1):131-9. doi: 10.1042/0264-6021:3540131. PMID: 11171088; PMCID: PMC1221637. 2. Wilczek, A. and Mishima, Y. (1995) Inhibitory effects of melanin monomers, dihydroxyindole-2-carboxylic acid (DHICA) and dihydroxyindole (DHI) on mammalian tyrosinase, with a special reference to the role of DHICA/DHI ratio in melanogenesis. Pigment Cell Res. 8, 105–112. 3.Branza-Nichita, Norica; Petrescu, Andrei J.; Negroiu, Gabriela; Dwek,Raymond A.; Petrescu, Stefana M. (2000). N Glycosylation Processing and Glycoprotein Folding−Lessons from the Tyrosinase-Related Proteins. Chemical Reviews, 100(12), 4697–4712. doi:10.1021/cr990291y. |
|---|
