Primary Information |
|---|
| BoMiProt ID | Bomi3527 |
|---|
| Protein Name | 40S ribosomal protein SA |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P26452 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_776804.1 |
|---|
| Aminoacid Length | 295 |
|---|
| Molecular Weight | 32884 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | RPSA |
|---|
| Gene ID | 281898 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | assembly and/or stability of the 40S ribosomal subunit.processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits.cell surface receptor for laminin.cell adhesion to the basement membrane .cell fate determination and tissue morphogenesis. receptor for several other ligands, including the pathogenic prion protein, viruses Flaviviruses, including the dengue virus (DENV), Alphaviruses, including the Sindbis virus (SINV)and bacteria. Acts as a PPP1R16B-dependent substrate of PPP1CA. RPSA is a receptor for epigallocatechin-gallate (EGCG), which is a major constituent of green tea and has many health related effects.The N-domain of RPSA is homologous to the ribosomal protein S2 (RPS2) of prokaryotes. |
|---|
| Biochemical Properties | Monomer (37LRP) and homodimer (67LR).Interacts with RPS21.Component of the small ribosomal subunit. Serial deletions of RPSA have shown that the segment of residues 236-262, included in the C-domain, is involved in the interaction between RPSA and the 40S subunit of ribosome.the anticodon binding domain of Lysyl-tRNA synthetase binds directly to the C-domain of RPSA. |
|---|
| Significance in milk | Bovine mammary protein synthesis |
|---|
| PTMs | Acetylation on Lys and Ser, Phosphorylation on Ser and Thr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P26452|RSSA_BOVIN 40S ribosomal protein SA OS=Bos taurus OX=9913 GN=RPSA PE=2 SV=4
MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKS*43DGIYIINLKRTWEKLLL
AARAIVAIENPADVSVISSRNTGQRAVLKFAAATGAT*97PIAGRFTPGTFTNQIQAAFREPR
LLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAR
EVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTA
AQPEVADWSEGVQVPSVPIQQFPTEDWSAQPSTEDWSAAPTAQATEWVGTTTEWS
|
|---|
| Predicted Disorder Regions | 1 disordered segment; (197-295) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Acylation may be a prerequisite for conversion of the monomeric 37 kDa laminin receptor precursor (37LRP) to the mature dimeric 67 kDa laminin receptor (67LR), and may provide a mechanism for membrane association.Cleaved by stromelysin-3 (ST3) at the cell surface.Cleavage by stromelysin-3 may be a mechanism to alter cell-extracellular matrix interactions. |
|---|
| Linking IDs | |