Primary Information |
---|
BoMiProt ID | Bomi3524 |
---|
Protein Name | 40S ribosomal protein S6 |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q5E995 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001015548.1 |
---|
Aminoacid Length | 249 |
---|
Molecular Weight | 28667 |
---|
FASTA Sequence |
Download |
---|
Gene Name | RPS6 |
---|
Gene ID | 787914 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Protein Function | Ribosomal protein S6 (RPS6) is a component of the 40S small ribosomal subunit and participates in the control of mRNA translation. |
---|
Biochemical Properties | RPS6 has five evolutionarily conserved C-terminal serine residues (S235, S236, S240, S244, and S247) that are phosphorylated by various protein kinases. |
---|
PTMs | N6-Acetylation at Lys, Hydroxylation, Isopeptide bond formation, Phosphorylation at Ser, Ubl conjugation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q5E995|RS6_BOVIN 40S ribosomal protein S6 OS=Bos taurus OX=9913 GN=RPS6 PE=2 SV=1
MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQG
FPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKD
IPGLTDTTVPRRLGPKRASRIRKLFNLS*148KEDDVRQYVVRKPLNKDGKKPRTKAPKIQRLV
TPRVLQHKRRRIALKKQRTKKNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLS*235S*236LRAS*240
TS*242KS*244ESS*247QK
|
---|
Predicted Disorder Regions | 80-90, 138-145, 152-209, 218-249 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | RPS6 is also phosphorylated at S235/236 by PAS domain-containing serine/threonine-protein kinase (PASK), which regulates translation and glycogen synthesis in mammalian cells. |
---|
Bibliography | 1.Yi YW, You KS, Park JS, Lee SG, Seong YS. Ribosomal Protein S6: A Potential Therapeutic Target against Cancer? Int J Mol Sci. 2021 Dec 21;23(1):48. doi: 10.3390/ijms23010048. PMID: 35008473; PMCID: PMC8744729. 2.Schläfli P., Tröger J., Eckhardt K., Borter E., Spielmann P., Wenger R.H. Substrate preference and phosphatidylinositol monophosphate inhibition of the catalytic domain of the Per-Arnt-Sim domain kinase PASKIN. FEBS J. 2011;278:1757–1768. doi: 10.1111/j.1742-4658.2011.08100.x. |