Primary Information |
|---|
| BoMiProt ID | Bomi3519 |
|---|
| Protein Name | 40S ribosomal protein S28 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q56JX6 |
|---|
| Milk Fraction | Whey,exosome |
|---|
| Ref Sequence ID | NP_001020487.1 |
|---|
| Aminoacid Length | 69 |
|---|
| Molecular Weight | 7841 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | RPS28 |
|---|
| Gene ID | 282877 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | structural constituent of ribosome |
|---|
| Biochemical Properties | Ribosomal protein S28 has 69 amino acids and has a molecular weight of 7,836. |
|---|
| PTMs | Acetylation and phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q56JX6|RS28_BOVIN 40S ribosomal protein S28 OS=Bos taurus OX=9913 GN=RPS28 PE=3 SV=1
MDTSRVQPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRS*41IIRNVKGPVREGDVLTLLE
SEREARRLR
|
|---|
| Predicted Disorder Regions | 1 disordered segment; (1-69) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | Chan YL, Olvera J, Wool IG. The primary structure of rat ribosomal protein S28. Biochem Biophys Res Commun. 1991 Aug 30;179(1):314-8. doi: 10.1016/0006-291x(91)91371-i. PMID: 1679328. |
|---|
