Primary Information |
|---|
| BoMiProt ID | Bomi3449 |
|---|
| Protein Name | 12S rRNA N4-methylcytidine methyltransferase/
12S rRNA m4C methyltransferase/Methyltransferase 5 domain-containing protein 1/Methyltransferase-like protein 15 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A0JN95 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001073250.1 |
|---|
| Aminoacid Length | 407 |
|---|
| Molecular Weight | 45768 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | METTL15/METT5D1 |
|---|
| Gene ID | 533987 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | METTL15 is required for mitochondrial function, delineate the evolution of methyltransferase substrate specificities and modification patterns in rRNA, and highlight a differential impact of m4C methylation on prokaryotic ribosomes and eukaryotic mitochondrial ribosomes. |
|---|
| Biochemical Properties | METTL15 is a member of the methytransferase like (METTL) family, characterized by the presence of a binding domain for S-adenosyl methionine, which is a methyl-group donor for methylation reactions |
|---|
| PTMs | Phosphorylation at Ser,Omega-N-methylation at Arginine |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A0JN95|MET15_BOVIN 12S rRNA N4-methylcytidine methyltransferase OS=Bos taurus OX=9913 GN=METTL15 PE=2 SV=1
MLRYPYFCRIHKNFLSCWLESGIYNLGVWPKKIHATAERYNEYEAQEETDQTGIQELHRS
QDRDSGVMTKLHIPVMVDEVVRCLAPQKGQVFLDMTFGSGGHTRAILQKEPDITLYALDR
DPTAYAIAEQLSELYPKQIRAILGQFSQAEALLMKAGVQPGTLDGVLLDLGCSSMQLDTP
ERGFSLRKDGPLDMRMDGDRYPDMPTAADVVNALDQQALASILRAYGEEKHAKKIASAII
QARGLYPITRTQQLASIVAGAFPPSALYARKDLLQRPTHIATKTFQAFRIFVNNELNELY
TGLKTAQKFLRPGGHLVALSFHSLEDRIIKRFLLGISMTERFNLSARQKVIQKSQLDS*358DQ
ENKEGVSTGKAPLMWKLIHKKVLTPEDEDVQDNPRGRSAKLRAAIKL
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | METTL15 depletion results in impaired translation of mitochondrial protein-coding mRNAs and decreases mitochondrial respiration capacity. |
|---|
| Bibliography | 1.Chen H, Shi Z, Guo J, Chang KJ, Chen Q, Yao CH, Haigis MC, Shi Y. The human mitochondrial 12S rRNA m4C methyltransferase METTL15 is required for mitochondrial function. J Biol Chem. 2020 Jun 19;295(25):8505-8513. doi: 10.1074/jbc.RA119.012127. Epub 2020 May 5. PMID: 32371392; PMCID: PMC7307190. |
|---|
