Primary Information |
|---|
| BoMiProt ID | Bomi3446 |
|---|
| Protein Name | 10 kDa heat shock protein, mitochondrial/Chaperonin 10/ |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P61603 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_776771.1 |
|---|
| Aminoacid Length | 102 |
|---|
| Molecular Weight | 10932 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | HSPE1 |
|---|
| Gene ID | 281833 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | adrenal gland |
|---|
| Protein Function | Cpn10 is a heat shock protein that functions as a molecular chaperone. It binds to and stabilizes cpn60 and these molecules mediate protein folding in mitochondria, chloroplasts and bacteria. Extracellular chaperonin 10 augments apoptotic cell death induced by 5-fluorouracil in human colon cancer cells. |
|---|
| Biochemical Properties | Homoheptamer arranged in a ring structure. 2 heptameric Hsp10 rings interact with a Hsp60 tetradecamer in the structure of a back-to-back double heptameric ring to form the symmetrical football complex.It's predicted protein sequence differs from rat at residue number 52 where Gly is replaced by Ser.Aminoacid sequence is 63% identical to rat. |
|---|
| PTMs | N-Acetylation at Ala, Phosphorylation at Thr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P61603|CH10_BOVIN 10 kDa heat shock protein, mitochondrial OS=Bos taurus OX=9913 GN=HSPE1 PE=3 SV=2
MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGT79*KVVLDDKDYFLFRDGDILGKYVD
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | 1.Kim K, Yeo SG. Extracellular chaperonin 10 augments apoptotic cell death induced by 5-fluorouracil in human colon cancer cells. Tumori. 2014 Nov-Dec;100(6):e230-5. doi: 10.1700/1778.19282. PMID: 25688504. 2.Cavanagh AC. Identification of early pregnancy factor as chaperonin 10: implications for understanding its role. Rev Reprod. 1996 Jan;1(1):28-32. doi: 10.1530/ror.0.0010028. PMID: 9414435. |
|---|
