Primary Information | |
---|---|
BoMiProt ID | Bomi313 |
Protein Name | decorin |
Organism | Bos taurus |
Uniprot ID | P21793 |
Milk Fraction | Exosome |
Ref Sequence ID | NP_776331.2 |
Aminoacid Length | 360 |
Molecular Weight | 39879 |
FASTA Sequence | Download |
Gene Name | DCN |
Gene ID | 280760 |
Protein Existence Status | Reviewed: Experimental evidence at protein level |
Secondary Information | |
Protein Function | proteoglycan known to impact mammary cell proliferation in humans and rodents; regulate fibrillogenesis; positively or negatively affect cell proliferation. Decorin is a prototype member of the SLRP family found in a variety of tissues and is expressed in the stroma of various forms of cancer. Decorin has gained recognition for its essential roles in inflammation, fibrotic disorders, and cancer, and due to its antitumor properties, it has been proposed to act as a "guardian from the matrix." |
Biochemical Properties | C-terminal region of decorin is cysteine-rich, the central region is made of twelve leucine-rich repeats and is generally recognized as a ligand-binding domain (discussed in further detail below), and the N-terminal region contains the single a single chondroitin/dermatan sulfate side chain and a distinct pattern of cystine residues |
Significance in milk | ECM proteoglycan known to impact mammary cell proliferation in humans and rodents |
PTMs | covalent linkage of GAG chains; specifically, the addition of a single chondroitin or dermatan sulfate side chain on a serine residue on the N-terminal side of decorin. Disulfide bond formation.Glycosylation at Asn-212; Asn-263 and Asn-304. |
Site(s) of PTM(s) N-glycosylation, O-glycosylation, Phosphorylation | >sp|P21793|PGS2_BOVIN Decorin OS=Bos taurus OX=9913 GN=DCN PE=1 SV=2 MKATIIFLLVAQVSWAGPFQQKGLFDFMLEDEAS*34GIGPEEHFPEVPEIEPMGPVCPFRCQCHLRVVQCSD LGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKN QLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTN*212ITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDN*263GSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNN*304ISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQLGNYK |
SCOP | Class : Alpha and beta proteins (a/b) Fold : Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Superfamily : L domain-like Family : Ngr ectodomain-like Domain Name : 1XKU A:22-326 |
CATH | Matched CATH superfamily 3.80.10.10 |
Predicted Disorder Regions | (37-50) |
DisProt Annotation | |
TM Helix Prediction | No TM helices |
Significance of PTMs | The attached glycosaminoglycan chain can be either chondroitin 4-sulfate, chondroitin 6-sulfate or dermatan sulfate, depending upon the tissue of origin. |
PDB ID | 1XCD, 1XEC, 1XKU, |
Bibliography | 1. Schaefer, L. and Iozzo, R. V. (2008) ‘Biological Functions of the Small Leucine-rich Proteoglycans: From Genetics to Signal Transduction’, Journal of Biological Chemistry, 283(31), pp. 21305–21309. doi: 10.1074/jbc.R800020200. 2. Reed, C. C. and Iozzo, R. V. (2002) ‘The role of decorin in collagen fibrillogenesis and skin homeostasis’, Glycoconjugate Journal, 19(4/5), pp. 249–255. doi: 10.1023/A:1025383913444. 3. Scott, J. E. (1995) ‘Extracellular matrix, supramolecular organisation and shape.’, Journal of anatomy, 187 ( Pt 2), pp. 259–69. Available at: http://www.ncbi.nlm.nih.gov/pubmed/7591990 (Accessed: 4 October 2019). 4. Moses, J. et al. (1997) ‘Biosynthesis of the proteoglycan decorin -- identification of intermediates in galactosaminoglycan assembly.’, European journal of biochemistry, 248(3), pp. 767–74. doi: 10.1111/j.1432-1033.1997.t01-1-00767.x. 5.Scott PG, McEwan PA, Dodd CM, Bergmann EM, Bishop PN, Bella J. Crystal structure of the dimeric protein core of decorin, the archetypal small leucine-rich repeat proteoglycan. Proc Natl Acad Sci U S A. 2004 Nov 2;101(44):15633-8. doi: 10.1073/pnas.0402976101. Epub 2004 Oct 22. PMID: 15501918; PMCID: PMC524833. 6.Baghy K, Reszegi A, Tátrai P, Kovalszky I. Decorin in the Tumor Microenvironment. Adv Exp Med Biol. 2020;1272:17-38. doi: 10.1007/978-3-030-48457-6_2. PMID: 32845500. |