Primary Information |
---|
BoMiProt ID | Bomi2098 |
---|
Protein Name | Fibroblast growth factor-binding protein 1 |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q9MZ06 |
---|
Milk Fraction | Whey, Exosome |
---|
Ref Sequence ID | NP_776762.1 |
---|
Aminoacid Length | 234 |
---|
Molecular Weight | 26188 |
---|
FASTA Sequence |
Download |
---|
Gene Name | FGFBP1 |
---|
Gene ID | 281812 |
---|
Protein Existence Status | Reviewed: Experimental evidence at protein level |
---|
Secondary Information |
---|
Protein Function | FGF-BP1 is an extracellular matrix bound protein that enhances fibroblast growth factor (FGF) signaling. |
---|
Biochemical Properties | A novel element in the region from -785 to -782 bp of the FGF-BP1 promoter, which represents a known binding site for Hypermethylation in Cancer-1 (Hic-1), necessary for repression of FGF-BP1 by TGF-beta. |
---|
PTMs | Disulfide bond formation, N-Linked and O-Linked Glycosylation at Asn and Ser respectively |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q9MZ06|FGFP1_BOVIN Fibroblast growth factor-binding protein 1 OS=Bos taurus OX=9913 GN=FGFBP1 PE=1 SV=1
MRTHGLTLLSLLLLAVPMLLVEAKKEGRNRRGSKASADESLALGKPGKEPRSQPTNYPIK
GKFVTPDHADCRWAVTKQEEGIVLKVECTQRDNTFSCFFTGNPTSCLELHKNNAYWKQIG
RNLRSQKVICGDAKSVLKTRVCRKKFPESNLKLVN*155STLIRIKKPSQELMEPS*172PMDTVEVT
TSSSPEKTQTMATKDPQCEEEDLKNQRKAALEYCGETWGSLCNFFLSMVQGSSC |
---|
Predicted Disorder Regions | 25-59,169-200 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Bibliography | Briones VR, Chen S, Riegel AT, Lechleider RJ. Mechanism of fibroblast growth factor-binding protein 1 repression by TGF-beta. Biochem Biophys Res Commun. 2006 Jun 30;345(2):595-601. doi: 10.1016/j.bbrc.2006.04.052. Epub 2006 Apr 25. PMID: 16690027. |