Primary Information |
|---|
| BoMiProt ID | Bomi132 |
|---|
| Protein Name | Angiogenin2 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P80929 |
|---|
| Milk Fraction | Whey |
|---|
| Aminoacid Length | 123 |
|---|
| Molecular Weight | 14522 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | ANG2 |
|---|
| Protein Existence Status | Reviewed: Experimental evidence at protein level |
|---|
Secondary Information |
|---|
| Protein Function | cell adhesion , nuclear translocation
, actin binding , inhibition of cell-free translation or
hydrolysis of tRNA; highly active in inducing blood-vessel
growth |
|---|
| Biochemical Properties | basic angiogenic protein that binds tightly to placental ribonuclease
inhibitor; the amino-terminal and carboxyl-terminal residues are pyroglutamic
acid and proline; ribonucleolytic activity that is similar to, but
somewhat lower than bovine angiogenin 1; angiogenically
potent on chicken chorioallantoic membrane; bovine angiogenin-2 was 20 kDa, larger than
that of bovine angiogenin-I (14kDa) |
|---|
| Significance in milk | Milk contains considerably more bovine angiogenin than
does serum; binds to PRI but had very little RNase
activit |
|---|
| PTMs | cross-linked by three disulfide bonds, is glycosylated at Asn33; contained 5 - 6 mannose, 2- 3 glucosamine,
1-2 galactosamine, up to one xylose and no sialic acid
residues; |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P80929|ANG2_BOVIN Angiogenin-2 OS=Bos taurus OX=9913 GN=ANG2 PE=1 SV=1
QNDAYRGFLRKHYDPSPTGHDDRYCNTMMERRN*33MTRPCKDTNTFIHGNSDDIRAVCDDRN
GEPYRNGLRRSRSPFQVTTCRHRGGSPRPPCRYRAFRANRVIVIRCRDGFPIHLEENFIP
PRP |
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | modification of bovine angiogenin-2 is on
Am33 and should physically cover a large surface area of bovine
angiogenin-2, as on RNase B, some
modulation of nuclear translocation may be possible, even
though bovine angiogenin-2 is an active angiogenic molecule |
|---|
| Bibliography | 1. Strydom, D. J., Bond, M. D., & Vallee, B. L. (1997). An angiogenic protein from bovine serum and milk--purification and primary structure of angiogenin-2. European Journal of Biochemistry, 247(2), 535–544. https://doi.org/10.1111/j.1432-1033.1997.00535. |
|---|
