Primary Information | |
|---|---|
| BoMiProt ID | Bomi119 |
| Protein Name | Osteopontin |
| Organism | Bos taurus |
| Uniprot ID | P31096 |
| Milk Fraction | Whey |
| Ref Sequence ID | NP_776612.1 |
| Aminoacid Length | 278 |
| Molecular Weight | 30904 |
| FASTA Sequence | Download |
| Gene Name | SPP1 |
| Gene ID | 281499 |
| Protein Existence Status | Reviewed: Experimental evidence at protein level |
Secondary Information | |
| Presence in other biological fluids/tissue/cells | blood, urine, seminal fluid |
| Protein Function | Inhibition of ectopic calcification, bone remodelling, cancer metastasis and immune modulatory functions; act as an opsonin, as it binds directly to several bacterial strains leading to enhanced phagocytosis by macrophages; can induce Th1 type immunity by inducing interleukin-12 expression in macrophages |
| Biochemical Properties | resistant to proteolysis by neonatal gastric juice;very resistant to harsh conditions; e.g., heat treatment at 90 C has no effect on the post-translational modifications decorating the protein;Proteolytic cleavage close to the integrin binding motifs has been demonstrated to increase the integrin binding properties of OPN; Milk OPN is a very acidic protein due to a high degree of negatively charged amino acids and the many phosphorylations decorating the protein; |
| Significance in milk | OPN plays a role in the development of the infant and could provide an important immunological signal during development; OPN, which possess known cytokine-like properties, was the most abundantly expressed when compared with the expression of 240 cytokine related genes in human milk; involved in mammary gland development and differentiation; bind and form soluble complexes with calcium ions which together with especially the caseins, could inhibit unintentional precipitation of amorphous calcium phosphate in milk; act as a transporter of these immunomodulating and antimicrobial proteins to their site of action and to protect them from proteolysis |
| PTMs | Phosphorylated glycoprotein; ~25 phosphates distributed over 36 potential sites in human milk osteopontin; ~22 phosphates distributed over 28 potential sites in bovine milk osteopontin; Bovine milk OPN contains three O-glycosylated threonine residues close to the integrin binding motifs; The glycan structures on human milk OPN have been shown to consist of large fucosylated N-acetyllactosamine units; the carbohydrates on bovine OPN consist of a disialylated GalNAc-galactose cores |
| Site(s) of PTM(s) N-glycosylation, O-glycosylation, Phosphorylation | >sp|P31096|OSTP_BOVIN Osteopontin OS=Bos taurus OX=9913 GN=SPP1 PE=1 SV=2 MRIAVICFCL LGIASALPVK PT S*23S*24GS*26S*27EEK QLNNKYPDAV ATWLKPDPSQ KQTFLAPQN S*60VS*62S*63EETDDNK QNTLP S*76KS*78NES*81PEQTDDLDD DDDNS*95QDVN S*100NDS*103DDAETTDDPDHS*115DESHHS*121DES*124DEVDFPT*131DIPTIAVFT*140 PFIPT*145ESANDGRGDSVAYGLKSRSKKFRRSNVQSPDAT*178EE DFTS*184HIES*188EE MHDAPKKTSQLTDHS*205KETNS*210 SELSKELTPK AKDKNKHSNL IES*233QENSKLS*240 QEFHS*245LEDKLDLDHKS*256EEDK HLKIRIS*267HEL DS*272AS*274SEVN |
| Predicted Disorder Regions | (1-278) |
| DisProt Annotation | |
| TM Helix Prediction | No TM helices |
| PDB ID | 2dxr, 2dxy, 2dyx, 2e0s, 2e1s, 2fa7, 2g93, 2h4i, 2hca, 2md1, 2md2, 2md3, 2md4, 2nuv, 2nwj, 2o1l, 2o51, 2ocu, 2p1s, 2px1, 2q8j, 2qje, 2r71, 2r9j, 2zmb, 3cfl, 3ci8, 3crb, 3e9x, 3iaz, 3ib0, 3ib1, 3ib2, 3k0v, 3kj7, 3mjn, 3mjn, 3o97, 3rgy, 3sdf, 3taj, 3tod, 3tus, 3u72, 3u8q, 3ugw, 3uk4, 3usd, 3v5a,3vdf, 4dig, 4dxu, 4fim, 4fjp, 4for, 4g2z, 4g77, 4g8h, 4grk, 4n6p, 4ned, 4oqo, 5cry, 5hbc, 1blf, 1lfc, 1nkx, 1sdx, 1y58, 2alu, 2ays, 2b65, 2doj, 2dp8, 2dqv, 2ds9, 2dsf, 2dvc, 2dwa, 2dwh, 2dwi, 2dwj, |
| Bibliography | 1. Bautista, D. S., Saad, Z., Chambers, A. F., Tonkin, K. S., O’Malley, F. P., Singhal, H., Tokmakejian, S., Bramwell, V., and Harris, J. F. (1996) Quantification of osteopontin in human plasma with an ELISA: basal levels in pre- and postmenopausal women. Clin. Biochem. 29, 231–239. 2. Senger, D. R., Perruzzi, C. A., Papadopoulos, A., and Tenen, D. G. (1989) Purification of a human milk protein closely similar to tumor-secreted phosphoproteins and osteopontin. Biochim. Biophys. Acta 996, 43–48. 3. Hoyer, J. R., Otvos, L., and Urge, L. (1995) Osteopontin in urinary stone formation. Ann. N. Y. Acad. Sci. 760, 257–265. 4. Cancel, A. M., Chapman, D. A., and Killian, G. J. (1999) Osteopontin localization in the Holstein bull reproductive tract. Biol. Reprod. 60, 454–460. 5. Anborgh, P. H., Mutrie, J. C., Tuck, A. B., and Chambers, A. F. (2011) Pre- and post-translational regulation of osteopontin in cancer. J. Cell Commun. Signal. 5, 111–122. 6. Schack, L., Stapulionis, R., Christensen, B., Kofod-Olsen, E., Skov Sorensen, U. B., Vorup-Jensen, T., Sorensen, E. S., and Hollsberg, P. (2009) Osteopontin Enhances Phagocytosis through a Novel Osteopontin Receptor, the X 2 Integrin. J. Immunol. 182, 6943–6950. 7. Schack, L., Stapulionis, R., Christensen, B., Kofod-Olsen, E., Skov Sorensen, U. B., Vorup-Jensen, T., Sorensen, E. S., and Hollsberg, P. (2009) Osteopontin Enhances Phagocytosis through a Novel Osteopontin Receptor, the X 2 Integrin. J. Immunol. 182, 6943–6950. 8. Chatterton, D. E. ., Rasmussen, J. ., Heegaard, C. ., Sørensen, E. ., and Petersen, T. . (2004) In vitro digestion of novel milk protein ingredients for use in infant formulas: Research on biological functions. Trends Food Sci. Technol. 15, 373–383. 9. Ashkar, S., Weber, G. F., Panoutsakopoulou, V., Sanchirico, M. E., Jansson, M., Zawaideh, S., Rittling, S. R., Denhardt, D. T., Glimcher, M. J., and Cantor, H. (2000) Eta-1 (osteopontin): an early component of type-1 (cell-mediated) immunity. Science 287, 860–864. 10. Agnihotri, R., Crawford, H. C., Haro, H., Matrisian, L. M., Havrda, M. C., and Liaw, L. (2001) Osteopontin, a Novel Substrate for Matrix Metalloproteinase-3 (Stromelysin-1) and Matrix Metalloproteinase-7 (Matrilysin). J. Biol. Chem. 276, 28261–28267. 11. Christensen, B., Kläning, E., Nielsen, M. S., Andersen, M. H., and Sørensen, E. S. (2012) C-terminal modification of osteopontin inhibits interaction with the αVβ3-integrin. J. Biol. Chem. 287, 3788–3797. 12. Boskey, A. L., Christensen, B., Taleb, H., and Sørensen, E. S. (2012) Post-translational modification of osteopontin: Effects on in vitro hydroxyapatite formation and growth. Biochem. Biophys. Res. Commun. 419, 333–338. 13. Sørensen, E. S., Petersen, T. E., and Højrup, P. (1995) Posttranslational modifications of bovine osteopontin: Identification of twenty-eight phosphorylation and three O -glycosylation sites. Protein Sci. 4, 2040–2049. |