Primary Information |
---|
BoMiProt ID | Bomi10802 |
---|
Protein Name | Zinc-binding alcohol dehydrogenase domain-containing protein 2 |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q24K16 |
---|
Milk Fraction | Whey,MFGM |
---|
Ref Sequence ID | NP_001069432.1 |
---|
Aminoacid Length | 377 |
---|
Molecular Weight | 40119 |
---|
FASTA Sequence |
Download |
---|
Gene Name | ZADH2 |
---|
Gene ID | 532505 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | Negatively regulates adipogenesis through regulation of PPARγ activity.PTGR-3 decreases proadipogenic effect of 15-keto-PGE2 through regulation of PPARγ activity.PTGR-3 may play a role in maintaining the undifferentiated state in preadipocytes. |
---|
Biochemical Properties | is a 15-oxoprostaglandin-Δ13-reductase.15-keto-PGE2 can be metabolized to 13,14-dihydro-15-keto-PGE2 by PTGR-3 in a NADPH-dependent reaction and that this reaction was linearly accelerated with increased concentration of PTGR-3 recombinant protein.PTGR-3 is able to catalyze the metabolism of other prostaglandins, including 15-keto-PGF2α, 15-keto-PGF1α, and 15-keto-PGEPTGR-3 is able to catalyze the metabolism of other prostaglandins, including 15-keto-PGF2α, 15-keto-PGF1α, and 15-keto-PGE1.PTGR-3 had the highest efficiency for 15-keto-PGF2α catabolic reaction (Kcat/Km= 271.76 ± 8.82 mM−1 min−1 compared with 15-keto-PGF1α (214.41 ± 12.92 mM−1 min−1), 15-keto-PGE2 (157.24 ± 14.00 mM−1 min−1) and 15-keto-PGE1 (58.45 ± 4.59 mM−1 min−1). |
---|
PTMs | Acetylation on Lys, Phosphorylation on Ser |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q24K16|PTGR3_BOVIN Prostaglandin reductase-3 OS=Bos taurus OX=9913 GN=ZADH2 PE=2 SV=1
MQRLALAGTRAIVDMSYARHFLDFQGSAIPSKMQKLVVTRLSPNFREAVTLRRDCPVPLP
GDGDLLVRNRFVGVNASDINYSAGRYDPSVKTPFDAGFEGVGEVVALGLSASAAFMVGQA
VAYMAPGSFAEYTVVPARVAIPVPGLKPEYLTLLVSGTTAYISLKELGGLSEGKKVLVTA
AAGGTGQFAVQLAKKAKCHVIGTCSSAEKSAFLKSVGCDRPINYNTEHVGTVLRQEYPQG
VDVVYESVGGAMFDLAVDALATRGRLIVIGFVSGYQTPTGLSPVKAGTLPAKLLKKSAS*299V
QGFFLNHYLPEFRGAMDHLLKMYAGGELVCEVDTGGLSAEGRFTGLESVFRAVDYMYMRK
NTGKIVVELPPSVNSKL
|
---|
Predicted Disorder Regions | NA |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | PTGR-3 protein may facilitate maintaining the undifferentiated state in preadipocytes by inhibiting endogenous 15-keto-PGE2 production and that suppression of PTGR-3 expression is required for normal adipocyte differentiation by regulating PPARγ transcriptional activity.PTGR-3 expression is reduced in adipose tissue from murine models of obesity. Modulation of PTGR-3 expression or activity might provide a novel avenue in treating obesity and related metabolic disorders. |
---|
Bibliography | Yu YH, Chang YC, Su TH, Nong JY, Li CC, Chuang LM. Prostaglandin reductase-3 negatively modulates adipogenesis through regulation of PPARγ activity. J Lipid Res. 2013 Sep;54(9):2391-9. doi: 10.1194/jlr.M037556. Epub 2013 Jul 2. PMID: 23821743; PMCID: PMC3735937. |