Primary Information |
|---|
| BoMiProt ID | Bomi10712 |
|---|
| Protein Name | Zinc finger protein 143/Selenocysteine tRNA gene transcription-activating factor |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A6QQW0 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001095624.1 |
|---|
| Aminoacid Length | 613 |
|---|
| Molecular Weight | 66079 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | ZNF143/STAF |
|---|
| Gene ID | 533243 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Zinc-finger protein 143 (ZNF143) on cancer cell motility in colon cancer cells.ZNF143 selectively expresses in duct and gland epithelium of normal breast tissues, which decreases when the tissue become malignant. |
|---|
| Biochemical Properties | ZNF143 is involved in cellular motility through a ZEB1-E-cadherin-linked pathway in colon cancer cells. |
|---|
| PTMs | Acetylation at Meth,Phosphorylation Thr,Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus OX=9913 GN=ZNF143 PE=2 SV=1
MLLAQINRDSQGMTEFPGGGMEAQHVTLCLTEAVTVADGDNLENMEGVSLQAVTLADGST
AYIQHNSKDGSAAYVQHVPIPKTTGDSLRLEDGQAVQLEDSYDQSALQAVQLEDGTTAYI
HHAVQVPQSDTILAIQADGTVAGLHTGDAAIDPDTISALEQYAAKVSIDGSEGVTGSGII
GENEQEKKMQIVLQGHATRVTAKSQQSGEKAFRCGYDGCGKLYTTAHHLKVHERSHTGDR
PYQCEHAGCGKAFATGYGLKSHVRTHTGEKPYRCSEDNCTKSFKTSGDLQKHIRTHTGER
PFKCHFEGCGRSFTTSNIRKVHIRTHT*327GERPYYCTEPGCGRAFASATNYKNHVRIHTGEK
PYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCNHCGKTYKQISTLAMHKRTAHNDTEP
IEEEQEAFFEPPPGQGEDVLKGSQITYVTGVEGDDVVSTQVATVTQSGLSQQVTLISQDG
TQHVNISQADMQAIGNTITMVTQDGTPITVPAHDAVISSAGAHSVAMVTAEGTEGQQVAI
VAQDLAAFHTASSEMGHQQHSHHLVTTETRPLTLVATSNGTQIAVQLGEQPSLEEAIRIA
SRIQQGETPGLDD
|
|---|
| Predicted Disorder Regions | 11-14, 465-489, 594-613 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | Loss of ZNF143 may contribute to the development of colon cancer by regulating intracellular and intercellular signalling for cell plasticity and the tumour microenvironment respectively. |
|---|
| Bibliography | 1.Paek AR, Mun JY, Hong KM, Lee J, Hong DW, You HJ. Zinc finger protein 143 expression is closely related to tumor malignancy via regulating cell motility in breast cancer. BMB Rep. 2017 Dec;50(12):621-627. doi: 10.5483/bmbrep.2017.50.12.177. PMID: 29065970; PMCID: PMC5749908. 2.Paek AR, Lee CH, You HJ. A role of zinc-finger protein 143 for cancer cell migration and invasion through ZEB1 and E-cadherin in colon cancer cells. Mol Carcinog. 2014 Feb;53 Suppl 1:E161-8. doi: 10.1002/mc.22083. Epub 2013 Sep 5. PMID: 24009065. 3.Verma V, Paek AR, Choi BK, Hong EK, You HJ. Loss of zinc-finger protein 143 contributes to tumour progression by interleukin-8-CXCR axis in colon cancer. J Cell Mol Med. 2019 Jun;23(6):4043-4053. doi: 10.1111/jcmm.14290. Epub 2019 Apr 1. PMID: 30933430; PMCID: PMC6533486. |
|---|
