Primary Information |
|---|
| BoMiProt ID | Bomi10692 |
|---|
| Protein Name | Zinc finger CCHC-type and RNA-binding motif-containing protein 1/U11/U12 small nuclear ribonucleoprotein 31 kDa protein/U11/U12 snRNP 31 kDa protein |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q56JZ7 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001020489.1 |
|---|
| Aminoacid Length | 217 |
|---|
| Molecular Weight | 24620 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | ZCRB1 |
|---|
| Gene ID | 504536 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | a nuclear protein remain outside the nucleolus,binds to RNA acts as transcription factor or repressor.Likely to be involved in morphine dependence, cold/heat stress, and hepatocarcinoma. |
|---|
| Biochemical Properties | The 5'-flanking region contains an enhancer core motif and binding sites for AP-1, AP-2, and LF-A1. ZCRB1 is characterized by an RNA-binding motif and a CCHC zinc finger motif. The latter overlaps the C..C...GH....C core nucleocapsid motif. ZCRB1 is conserved from zebrafish to human and shares homology with cold-inducible RNA-binding protein.Human ZCRB1 has significant homology with human SFRS7 RNA-splicing factor 9G8 (33%/116 aa), sex-lethal protein SXL2(39%/71 aa) of Lucilia cuprina, blowfly , and mouse cold-inducible RNA-binding protein (29%/110 aa). |
|---|
| PTMs | Phosphorylation on Ser and Thr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q56JZ7|ZCRB1_BOVIN Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Bos taurus OX=9913 GN=ZCRB1 PE=2 SV=1
MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRRSKGVAFILFLD
KDSAQNCTRAINNKQLFGRVIKASIAIDNGRAAEFIRRRNYFDKSKCYECGESGHLSYAC
PKNMLGEREPPKKKEKKKKKKIPEPEEEIEEVEES*155EDEGEDPALDSLSQAIAFQQAKIEE
EQKKWKPSSGGPSTSDDSRRPRIKKSTYFS*210DEEELS*216D
|
|---|
| Predicted Disorder Regions | 1-5, 43-47, 117-217 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | no TM helices |
|---|
| Additional Comments | ZCRB1 gene expression was found to be stimulated by morphine, inhibited by 30-36 degrees C, and up-regulated by 39 degrees C incubation in SH-SY5Y neural cells. Zcrb1 gene expression is highest in the heart and testes, lower in the cerebellum, and lowest in the liver in mice. |
|---|
| Bibliography | 1.Wang H, Gao MX, Li L, Wang B, Hori N, Sato K. Isolation, expression, and characterization of the human ZCRB1 gene mapped to 12q12. Genomics. 2007 Jan;89(1):59-69. doi: 10.1016/j.ygeno.2006.07.009. Epub 2006 Sep 7. PMID: 16959469. |
|---|
