Primary Information |
|---|
| BoMiProt ID | Bomi10685 |
|---|
| Protein Name | Zinc finger and BTB domain-containing protein 18/Zinc finger protein 238 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A0JN76 |
|---|
| Milk Fraction | Whey |
|---|
| Aminoacid Length | 522 |
|---|
| Molecular Weight | 58356 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | ZBTB18/ZNF238 |
|---|
| Gene ID | 538793 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | A nuclear DNA marker, ZNF238, can be used to increase the accuracy of species identification among euteleostomi (bony vertebrates). |
|---|
| Biochemical Properties | The nuclear gene ZNF238 is a common gene among euteleostomi and encodes zinc finger protein 238, which acts as a transcriptional activator or repressor and is involved in chromatin assembly |
|---|
| PTMs | Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A0JN76|ZBT18_BOVIN Zinc finger and BTB domain-containing protein 18 OS=Bos taurus OX=9913 GN=ZBTB18 PE=2 SV=2
MEFPDHSRHLLQCLSEQRHQGFLCDCTVLVGDAQFRAHRAVLASCSMYFHLFYKDQLDKR
DIVHLNSDIVTAPAFALLLEFMYEGKLQFKDLPIEDVLAAASYLHMYDIVKVCKKKLKEK
ATTEADSTKKEEDASSCSDKVESLSDGSSHMAGDLPS*157DEDEGEDEKLNILPSKRDLAAEP
GNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSSTESLSQRSVTSVRDSADVDCVL
DLSVKSSLSGVENLNSSYFSSQDVLRSNLVQVKVEKEASCDESDVGTNDYDMEHSTVKES
VSTNNRVQYEPAHLAPLREDSVLRELEREDKASDDEMMTPESERVQVEGGMESSLLPYVS
NILSPAGQIFMCPLCNKVFPSPHILQIHLSTHFREQDGLRSKPAADVNVPTCSLCGKTFS
CMYTLKRHERTHSGEKPYTCTQCGKSFQYSHNLSRHAVVHTREKPHACKWCERRFTQSGD
LYRHIRKFHCELVNSLSVKSEALSLPAVRDWTLEDS*516S*517QELWK
|
|---|
| Predicted Disorder Regions | 117-226, 245-288, 307-323, 334-342 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | zinc finger protein 238 (ZNF238), known as a tumor suppressor, was regulated by miR-20b over-expres-sion. |
|---|
| Bibliography | 1.Kim W, Kim S, Choi H, Truong ND, Thong le M, Kim JH, Xiao R, Park KK, Seo K, Lee H, Kim BS, Yoo MH, Park C. Discrimination of animal species using polymorphisms of the nuclear gene zinc finger protein 238. J Agric Food Chem. 2010 Feb 24;58(4):2398-402. doi: 10.1021/jf9036968. PMID: 20085280. 2.Lu L, Chen XM, Tao HM, Xiong W, Jie SH, Li HY. Regulation of the expression of zinc finger protein genes by microRNAs enriched within acute lymphoblastic leukemia-derived microvesicles. Genet Mol Res. 2015 Oct 5;14(4):11884-95. doi: 10.4238/2015.October.5.2. PMID: 26505336. 3.Aoki, K.; Meng, G.; Suzuki, K. RP58 associates with condensed
chromatin and mediates a sequence-specific transcriptional repression. J. Biol. Chem. 1998, 273, 26698–26704. |