Primary Information |
---|
BoMiProt ID | Bomi10631 |
---|
Protein Name | X-box-binding protein 1 |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q3SZZ2 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001029899.1 |
---|
Aminoacid Length | 261 |
---|
Molecular Weight | 28424 |
---|
FASTA Sequence |
Download |
---|
Gene Name | XBP1 |
---|
Gene ID | 541236 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | TF Required for cardiac myogenesis and hepatogenesis during embryonic development.regulates the transcription of genes involved in ER homeostasis. |
---|
Biochemical Properties | XBP-1 as a member of the basic region leucine zipper protein family |
---|
Significance in milk | regulates the biosynthetic capacity of mammary gland during lactation by controlling epithelial expansion and ER formation. |
---|
PTMs | Phosphorylation on Ser and ubiquitination |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3SZZ2|XBP1_BOVIN X-box-binding protein 1 OS=Bos taurus OX=9913 GN=XBP1 PE=2 SV=1
MVVVAPAQSPAAGAPKVLLLSGQPAATGGAPAGRALPVMVPGQQGAS*47PEGASGVPPQARK
RQRLTHLS*68PEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLR
EKTHGLVVENQELRQRLGMDALVTEEEAETKGNGAGLVAGSAESAALRLRAPLQQVQAQL
SPLQNISPWTLMALTLQTLSLTSCWAFCSTWTQSCSSDVLPQSLPAWSSSQKWTQKDPVP
YRPPLLHPWGRHQPSWKPLMN
|
---|
Predicted Disorder Regions | 4 disordered segments; (1-17), (22-89), (144-165), (228-261) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | When ER stress occurs, the IRE1α kinase is activated through autophosphorylation and acts as a stress sensor and transducer. IRE1α endoribonuclease activity then removes a 26 nucleotides intron from XBP-1u mRNA coding sequence inducing a frame shift. Thereafter, subsequent processed mRNA is translated onto a more stable 376 amino acids-long isoform XBP-1s (spliced), which bears the transcriptional activity. |
---|
Bibliography | Dunys J, Duplan E, Checler F. The transcription factor X-box binding protein-1 in neurodegenerative diseases. Mol Neurodegener. 2014 Sep 12;9:35. doi: 10.1186/1750-1326-9-35. PMID: 25216759; PMCID: PMC4166022. |