Primary Information | |
|---|---|
| BoMiProt ID | Bomi105 |
| Protein Name | Beta-casein |
| Organism | Bos taurus |
| Uniprot ID | P02666 |
| Milk Fraction | Whey |
| Aminoacid Length | 224 |
| Molecular Weight | 25107 |
| FASTA Sequence | Download |
| Gene Name | CSN2 |
| Protein Existence Status | Reviewed: Experimental evidence at protein level |
Secondary Information | |
| Endogenous/Bioactive peptides - Fragment - Sequence - Effect | ß casomorphin-11 - 60–70 - YPFPGPIPNSL - Opioid Ref ß casomorphin-7 - 60–66 - YPFPGPI - Opioid ACE Inhibitory, Immunomodulatory Ref ß casomorphin-5 - 60–64 - YPFPG - Opioid ACE Inhibitory Ref ß casokinin-7 - 177–183 - AVPYPQR - ACE Inhibitory Ref ß casokinin-10 - 193–202 YQQPVLGPVR - ACE Inhibitory, Immunomodulatory Ref 169–175 - KVLPVPQ - ACE inhibition Ref Immunopeptide - 63–68 - PGPIPN - Immunomodulatory Ref Immunopeptide - 191–193 - LLY - Immunomodulatory Ref ß casochemotide -1114–118 - YPVEP - Immunomodulatory Ref 210–221 - EPVLGPVRGPFP - ACE-inhibition Ref Caseinophosphopeptide - (1–25)4P -RELEELNVPGEIVESLSSSEESITR - Ca++ binding Ref |
| Protein Function | ß-caseinomorph stimulate human lymphocyte T proliferation in vitro; ha cytomodulatory properties; enhances nutritional quality in food becausenof high lysine content; film-forming properties of casein may also be used, either as coatings or to reduce oil absorption during the cooking/frying stage in preparing the food |
| Biochemical Properties | ß-caseinomorph, a peptide originating from ß-casein is very stable with regard to enzymatic degradation; a substrate for dipeptidyl peptidase IV; exhibits a strong opioid activity; insoluble at pH 4.6; coagulable following specifi c, limited proteolysis; pH 6.7 may be heated at 100ºC for 24 h without coagulation and withstands heating at 140ºC for up to 20–25 min; casein can be precipitated by any of several salts, usually by (NH 4 ) 2 SO 4 at 260 g/L or saturated NaCl; high levels of proline; lack of α - and β -structures; low in sulfur |
| Significance in milk | prime source of calcium and phosphorus for the neonate; antigen capable of inducing a prolonged immune response. Increased levels of casein antibodies have been found in individuals with schizophrenia before and after diagnosis |
| PTMs | Phosphorylated; presence of 5 phosphates in bovine; site of phosphorylation: Ser-Xxx-Glu/pSer; of 12 genetic variants of β -casein in bovine only two variants appear to have altered phosphorylation; Equine β -casein shows variation in phosphorylation, with typically 3 to 7 phosphates on full-length β -casein; the β -casein of human milk exists as six different forms with 0 to 5 phosphates; Ovine β -casein has variable phosphorylation, with 0 to 7 phosphates |
| Site(s) of PTM(s) N-glycosylation, O-glycosylation, Phosphorylation | >sp|P02666|CASB_BOVIN Beta-casein OS=Bos taurus OX=9913 GN=CSN2 PE=1 SV=2 MKVLILACLVALALARELEELNVPGEIVES*30LS*32S*32S*34EESITRINKKIEKFQS*50EEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV |
| Predicted Disorder Regions | 23-33,37-93,116-132,167-170 |
| DisProt Annotation | Disorder content 100% Term disorder : Fragment 1 - 224 Term disorder to molten globule: Fragment 1 - 224 Term ion binding, Fragment 1 - 224 Term : sequestering of metal ion, Fragment 1 - 224 |
| TM Helix Prediction | No TM helices |
| PDB ID | 1G4M, 1G4R, 1JSY, 1ZSH, 2WTR, 3GC3, 3GD1, 6NI2, 7DF9, 7DFA, 7DFB, 7DFC, |
| Bibliography | 1. Niebuhr, D. W., Li, Y., Cowan, D. N., Weber, N. S., Fisher, J. A., Ford, G. M., & Yolken, R. (2011). Association between bovine casein antibody and new onset schizophrenia among US military personnel. Schizophrenia Research, 128(1–3), 51–55. https://doi.org/10.1016/j.schres.2011.02.005. 2. Ferranti, P., Pizzano, R., Garro, G., Caira, S., Chianese, L., & Addeo, F. (2001). Mass spectrometry-based procedure for the identification of ovine casein heterogeneity. Journal of Dairy Research, 68(1), 35–51. https://doi.org/10.1017/S0022029900004611. 3. Greenberg, R., Groves, M. L., & Dower, H. J. (1984). Human beta-casein. Amino acid sequence and identification of phosphorylation sites. The Journal of Biological Chemistry, 259(8), 5132–5138. Retrieved from http://www.ncbi.nlm.nih.gov/pubmed/6715339. |