Primary Information |
|---|
| BoMiProt ID | Bomi10487 |
|---|
| Protein Name | Vitamin K-dependent protein Z |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P00744 |
|---|
| Milk Fraction | Whey |
|---|
| Aminoacid Length | 396 |
|---|
| Molecular Weight | 43113 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | PROZ |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | Plasma |
|---|
| Protein Function | Protein Z is a vitamin K-dependent protein that serves as a cofactor for the inhibition of activated factor X by the serpin protein Z-dependent protease inhibitor (ZPI). |
|---|
| PTMs | Disulfide bond formation,N-Linked glycosylation at Asn |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P00744|PROZ_BOVIN Vitamin K-dependent protein Z OS=Bos taurus OX=9913 GN=PROZ PE=1 SV=1
AGSYLLEELFEGHLEKECWEEICVYEEAREVFEDDETTDEFWRTYMGGSPCAS*53QPCLNN*59G
SCQDSIRGYACTCAPGYEGPNCAFAESECHPLRLDGCQHFCYPGPESYTCSCARGHKLGQ
DRRSCLPHDRCACGTLGPECCQRPQGSQQNLLPFPWQVKLTNSEGKDFCGGVLIQDNFVL
TTATCSLLYAN*191ISVKTRSHFRLHVRGVHVHTRFEADTGHNDVALLDLARPVRCPDAGRPV
CTADADFADSVLLPQPGVLGGWTLRGREMVPLRLRVTHVEPAECGRALN*289ATVTTRTSCER
GAAAGAARWVAGGAVVREHRGAWFLTGLLGAAPPEGPGPLLLIKVPRYALWLRQVTQQPS
RASPRGDRGQGRDGEPVPGDRGGRWAPT*388ALPPGPLV
|
|---|
| Predicted Disorder Regions | (356-396) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains. |
|---|
| Bibliography | 1.Sofi F, Cesari F, Tu Y, Pratesi G, Pulli R, Pratesi C, Gensini GF, Abbate R, Fedi S, Broze GJ Jr. Protein Z-dependent protease inhibitor and protein Z in peripheral arterial disease patients. J Thromb Haemost. 2009 May;7(5):731-5. doi: 10.1111/j.1538-7836.2009.03325.x. Epub 2009 Feb 18. Erratum in: J Thromb Haemost. 2009 Aug;7(8):1436. Fedi, S [added]. PMID: 19228280; PMCID: PMC2879329. 2.Højrup P, Jensen MS, Petersen TE. Amino acid sequence of bovine protein Z: a vitamin K-dependent serine protease homolog. FEBS Lett. 1985 May 20;184(2):333-8. doi: 10.1016/0014-5793(85)80633-5. PMID: 3888670. |
|---|
