Primary Information |
|---|
| BoMiProt ID | Bomi10481 |
|---|
| Protein Name | Vesicle-associated membrane protein 7/VAMP-7/Synaptobrevin-like protein 1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q17QI5 |
|---|
| Milk Fraction | Whey,MFGM |
|---|
| Ref Sequence ID | NP_001069770.1 |
|---|
| Aminoacid Length | 220 |
|---|
| Molecular Weight | 24962 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | VAMP7/SYBL1 |
|---|
| Gene ID | 613984 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | a vesicular SNARE protein,regulates autophagosome formation to maintain mitochondrial homeostasis and control insulin secretion in pancreatic β-cells. |
|---|
| Biochemical Properties | the profilin-like longin domain (LD) and the SNARE motif are required for autophagosome formation |
|---|
| PTMs | Acetylation on Ala and phosphorylation on Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q17QI5|VAMP7_BOVIN Vesicle-associated membrane protein 7 OS=Bos taurus OX=9913 GN=VAMP7 PE=2 SV=1
MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRI
VYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSEN
KGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDS*167S*168VTFKTTSRNLAR
AMCMKNLKLTIIIIIISVVFIYIIVSPLCGGFTWPNCVKK
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 1TMH; (190-212) |
|---|
| Bibliography | Aoyagi K, Itakura M, Fukutomi T, Nishiwaki C, Nakamichi Y, Torii S, Makiyama T, Harada A, Ohara-Imaizumi M. VAMP7 Regulates Autophagosome Formation by Supporting Atg9a Functions in Pancreatic β-Cells From Male Mice. Endocrinology. 2018 Nov 1;159(11):3674-3688. doi: 10.1210/en.2018-00447. PMID: 30215699. |
|---|
