Primary Information |
|---|
| BoMiProt ID | Bomi10430 |
|---|
| Protein Name | Urokinase plasminogen activator surface receptor/CD_antigen: CD87 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q05588 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_776848.1 |
|---|
| Aminoacid Length | 330 |
|---|
| Molecular Weight | 35989 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | PLAUR |
|---|
| Gene ID | 281983 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | placenta |
|---|
| Protein Function | Urokinase plasminogen activator receptor (u-PAR) binds urokinase plasminogen activator (u-PA) and participates in plasminogen activation in addition to modulating several cellular processes such as adhesion, proliferation, and migration. |
|---|
| Biochemical Properties | The region between domains 1 and 2 (D1 and D2) of the three-domain structure of u-PAR is sensitive to proteolysis by several proteases, including its activated ligand two-chain u-PA (tcu-PA), plasmin (Pn), and chymotrypsin |
|---|
| PTMs | Disulfide bond formation, N-Linked Glycosylation at Asn, GPI-anchor formation, Lipoylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q05588|UPAR_BOVIN Urokinase plasminogen activator surface receptor OS=Bos taurus OX=9913 GN=PLAUR PE=2 SV=1
MGQPLLLLLLVYTYIPGSWGLRCLQCEN*28TTSCSVEECTPGQDLCRTTVLSVWEGGNEMNV
VRKGCTHPDKTN*72RSMSYRAADQIITLSETVCRSDLCNKPNPGRDATVSRNRYLECASCSS
TDLSCERGWDQTMQCLKSRDQCVDVITHRSLKENPGDERHIRGCGILPGCPGPTGFHNN*179H
TFHFLRCCN*189TTKCNAGSVLELQNLPPNGLQCYSCEGNGAHRCSSEETFLIDCRGPMNQCL
EATGTKGLRNPSYTIRGCAAPSWCQSLHVAEAFDLTHVN*279VSCCTGSGCNHPARDDQPGKG
GAPKTSPAHLSFFVSLLLTARLWGATLLCT
|
|---|
| Predicted Disorder Regions | 293-305 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | 1.Nieves EC, Manchanda N. A cleavage-resistant urokinase plasminogen activator receptor exhibits dysregulated cell-surface clearance. J Biol Chem. 2010 Apr 23;285(17):12595-603. doi: 10.1074/jbc.M109.008581. Epub 2010 Feb 22. PMID: 20177061; PMCID: PMC2857136. 2.Høyer-Hansen G., Ronne E., Solberg H., Behrendt N., Ploug M., Lund L. R., Ellis V., Danø K. (1992) J. Biol. Chem. 267, 18224–18229. 3. Høyer-Hansen G., Ploug M., Behrendt N., Rønne E., Danø K. (1997) Eur. J. Biochem. 243, 21–26. 4.Montuori N., Rossi G., Ragno P. (1999) FEBS Lett. 460, 32–36. |
|---|
