Primary Information |
|---|
| BoMiProt ID | Bomi10257 |
|---|
| Protein Name | Ubiquitin-conjugating enzyme E2 C/(E3-independent) E2 ubiquitin-conjugating enzyme C (EC:2.3.2.24)/E2 ubiquitin-conjugating enzyme C/Ubiquitin carrier protein C/Ubiquitin-protein ligase C |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q32PA5 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001032526.1 |
|---|
| Aminoacid Length | 179 |
|---|
| Molecular Weight | 19608 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | UBE2C/UBCH10 |
|---|
| Gene ID | 506962 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | degradation of mitotic cyclins to regulate cell cycle progression.Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit. |
|---|
| PTMs | Acetylation, Phosphorylation, Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q32PA5|UBE2C_BOVIN Ubiquitin-conjugating enzyme E2 C OS=Bos taurus OX=9913 GN=UBE2C PE=2 SV=1
MAS*3QNRDPVAASVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLF
KWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKD
KWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVSSQDP |
|---|
| Predicted Disorder Regions | 1-30, 172-179 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | Jin Z, Zhao X, Cui L, Xu X, Zhao Y, Younai F, Messadi D, Hu S. UBE2C promotes the progression of head and neck squamous cell carcinoma. Biochem Biophys Res Commun. 2020 Mar 5;523(2):389-397. doi: 10.1016/j.bbrc.2019.12.064. Epub 2019 Dec 20. PMID: 31870550. |
|---|
