Primary Information |
|---|
| BoMiProt ID | Bomi10185 |
|---|
| Protein Name | U1 small nuclear ribonucleoprotein C/U1 snRNP C/:U1-C |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q32PA0 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001069802.1 |
|---|
| Aminoacid Length | 159 |
|---|
| Molecular Weight | 17394 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | SNRPC |
|---|
| Gene ID | 614553 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | component of U1 snRNP, which is necessary for 5' splice-site recognitionduring spliceosome mediated RNA Splicing(constitutive and regulated alternative splicing).Stimulates commitment or early (E) complex formation by stabilizing the base pairing of the 5' end of the U1 snRNA and the 5' splice-site region. |
|---|
| PTMs | Acetylation and phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q32PA0|RU1C_BOVIN U1 small nuclear ribonucleoprotein C OS=Bos taurus OX=9913 GN=SNRPC PE=2 SV=2
MPKFYCDY*8CDTYLTHDS*17PSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQG
KIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAP
GMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
|
|---|
| Predicted Disorder Regions | 3 disordered segments; (16-47), (51-61), (150-159) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
