Primary Information |
|---|
| BoMiProt ID | Bomi10174 |
|---|
| Protein Name | Tyrosine-protein kinase Fyn/Proto-oncogene c-Fyn/p59-Fyn |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A0JNB0 |
|---|
| Milk Fraction | Whey,Exosome,MFGM |
|---|
| Ref Sequence ID | NP_001071440.1 |
|---|
| Aminoacid Length | 537 |
|---|
| Molecular Weight | 60718 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | FYN |
|---|
| Gene ID | 527263 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | non-receptor tyrosine kinase of the Src family,involved in regulation of cell growth and survival, cell adhesion, integrin-mediated signaling, cytoskeletal remodeling, cell motility, immune response and axon guidance. |
|---|
| Biochemical Properties | Mn2+ as cofactor.Inhibited by phosphorylation of Tyr-531 by leukocyte common antigen and activated by dephosphorylation of this site.N-terminal domain has a number of tyrosine residues which lie within consensus sequences for binding by various families of SH2 domains.contains both SH2 and SH3 domains that are critical to the various regulatory functions of the protein. |
|---|
| PTMs | Phosphorylation,Myristoylation,Palmitoylation,Lipidation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A0JNB0|FYN_BOVIN Tyrosine-protein kinase Fyn OS=Bos taurus OX=9913 GN=FYN PE=2 SV=1
MGCVQCKDKEAT*12KLTEERDGS*21LNQSS*26GYRYGTDPTPQHYPSFGVTSIPNYNNFHGAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAY*185SLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY*420
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQY*531QPGENL
|
|---|
| Predicted Disorder Regions | 1-56, 528-535 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Phosphorylation on the C-terminal tail at Tyr-531 by CSK maintains the enzyme in an inactive state.PTPRC/CD45 dephosphorylates Tyr-531 leading to activation.Ultraviolet B strongly increase phosphorylation at Thr-12 and kinase activity, and promotes translocation from the cytoplasm to the nucleus.Phosphorylated on Ser residues by an isoform of PKC which is necessary for activation of Fyn in Keratinocytes.For full activity of Src Kinase activity,Tyr-419 within the activation loop of catalytic activity on Fyn must be autophosphorylated.Inactive FYN is phosphorylated on its C-terminal tail within the catalytic domain. Palmitoylation at Cys-3 and Cys-6, probably by ZDHHC21, regulates subcellular location. |
|---|
| Bibliography | 1.Edwards JC, Kapadia S. Regulation of the bovine kidney microsomal chloride channel p64 by p59fyn, a Src family tyrosine kinase. J Biol Chem. 2000 Oct 13;275(41):31826-32. doi: 10.1074/jbc.M005275200. PMID: 10930415. 2.Crosby D, Poole AW. Physical and functional interaction between protein kinase C delta and Fyn tyrosine kinase in human platelets. J Biol Chem. 2003 Jul 4;278(27):24533-41. doi: 10.1074/jbc.M301847200. Epub 2003 Apr 29. PMID: 12721299. |
|---|
