Primary Information |
---|
BoMiProt ID | Bomi10127 |
---|
Protein Name | Tubulin-folding cofactor B/Cytoskeleton-associated protein 1/Tubulin-specific chaperone B |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q5E951 |
---|
Milk Fraction | Exosomes |
---|
Ref Sequence ID | NP_001014939.1 |
---|
Aminoacid Length | 244 |
---|
Molecular Weight | 27518 |
---|
FASTA Sequence |
Download |
---|
Gene Name | TBCB |
---|
Gene ID | 530447 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Presence in other biological fluids/tissue/cells | scapular muscle |
---|
Protein Function | Tubulin folding cofactor B (TBCB) is an important member of the TBC family in cells. It is important for the proper folding of β-tubulin and the formation of α/β-tubulin heterodimers, which are critical for the normal growth of mammalian cells |
---|
PTMs | N-acetylation at Meth,Phosphorylation at Ser/Tyr |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q5E951|TBCB_BOVIN Tubulin-folding cofactor B OS=Bos taurus OX=9913 GN=TBCB PE=2 SV=1
MEVTGLSAPTVNVFISSSLNSFRSQKRYSRSLTVAEFKCKLQLVVGSPASCMELELYGPD
DKFCCKLDQDDALLGSYPVDDGCRIHVIDHSGARLGEY*98EDISKVEKYEIS*110QEAYEQRQDS
IRSFLKRNKLGRFNEEERAQQEAENSQRLIEEEAQASTIPVGSRCEVRTPGQPPRRGTVM
YVGLTDFKPGYWIGIRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPSVVTVGDFPEEDYG
LDEM
|
---|
Predicted Disorder Regions | 112-175 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | Ubiquitinated in the presence of GAN which targets it for degradation by the proteasome.Phosphorylation by PAK1 is required for normal function. |
---|
Additional Comments | The level of TBCB expression in breast cancer tissues was significantly upregulated, and TBCB overexpression may increase the degree of malignancy in breast cancer cells. |
---|
Bibliography | 1. Archer JE, Vega LR, Solomon F. Rbl2p, a yeast protein that binds to beta-tubulin and participates in microtubule function in vivo. Cell. 1995;82:425–434. doi: 10.1016/0092-8674(95)90431-X. 2.Gong J, Wang J, Tian Y, Zhang J, Liang W, Li Z, Yu J, Tang B, He S. Expression of tubulin folding cofactor B in mouse hepatic ischemia-reperfusion injury. Biomed Rep. 2017 May;6(5):525-531. doi: 10.3892/br.2017.891. Epub 2017 Apr 11. PMID: 28515911; PMCID: PMC5431315. 3.Hamel E, Sackett DL, Vourloumis D, Nicolaou KC. The coral-derived natural products eleutherobin and sarcodictyins A and B: Effects on the assembly of purified tubulin with and without microtubule-associated proteins and binding at the polymer taxoid site. Biochemistry. 1999;38:5490–5498. doi: 10.1021/bi983023n. |