Primary Information |
|---|
| BoMiProt ID | Bomi10087 |
|---|
| Protein Name | tRNA wybutosine-synthesizing protein 3 homolog/tRNA-yW-synthesizing protein 3/tRNA(Phe) 7-((3-amino-3-carboxypropyl)-4-demethylwyosine(37)-N(4))-methyltransferase |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q5E9U4 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001015620.1 |
|---|
| Aminoacid Length | 258 |
|---|
| Molecular Weight | 29303 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | TYW3 |
|---|
| Gene ID | 519731 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | S-adenosylmethionine (SAM)-dependent methyltransferases,responsible for the formation of a tRNA modification known as wybutosine and its derivatives that are required for accurate decoding in protein synthesis. |
|---|
| Biochemical Properties | the catalytic center contains sequence motif (S/T)xSSCxGR and invariant aspartate and histidine.Contains a GxGxG consensus sequence, which forms part of the SAM binding site.Contain CxxxCxxC motif near their N terminus. |
|---|
| PTMs | Phosphorylation on Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q5E9U4|TYW3_BOVIN tRNA wybutosine-synthesizing protein 3 homolog OS=Bos taurus OX=9913 GN=TYW3 PE=2 SV=1
MDLSAEFKRWKAQCLSKADLSRKGS*25VDEDVLEIVQLLNGQEQFFTTSSCAGRIILLDRSV
NGSEVQKQNCCWLLVTHKACVKDDVIVALQKAKGDAILKFEPLVLHVQCRQLQDAQILHS
VAIDSGFRNSGITVGKRGKTMLAVRSTHGLEVPLSHQGKLMVTEEYINFLLKIANQKMEE
NKKRIERFYHCLQHALEKETVSTTSQPKEKVNTSYIRKKKRNPGKARGKRVNEEHDKELE
NNDHDDPGISDTIFPEDY
|
|---|
| Predicted Disorder Regions | 1-4, 16-23, 199-258 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | Currie MA, Brown G, Wong A, Ohira T, Sugiyama K, Suzuki T, Yakunin AF, Jia Z. Structural and functional characterization of the TYW3/Taw3 class of SAM-dependent methyltransferases. RNA. 2017 Mar;23(3):346-354. doi: 10.1261/rna.057943.116. Epub 2016 Dec 8. PMID: 27932585; PMCID: PMC5311493. |
|---|
