Primary Information |
|---|
| BoMiProt ID | Bomi10081 |
|---|
| Protein Name | Tripartite motif-containing protein 2/E3 ubiquitin-protein ligase TRIM2/RING-type E3 ubiquitin transferase TRIM2 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A4IF63 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001077204.1 |
|---|
| Aminoacid Length | 744 |
|---|
| Molecular Weight | 81476 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | TRIM2 |
|---|
| Gene ID | 538617 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | It plays a neuroprotective role and functions as an E3-ubiquitin ligase in proteasome-mediated degradation of target proteins. TRIM2 also performs an important functions in regulating the development and metastasis of osteosarcoma. |
|---|
| Biochemical Properties | The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic filaments |
|---|
| PTMs | Phosphorylationa and Ubl Conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A4IF63|TRIM2_BOVIN Tripartite motif-containing protein 2 OS=Bos taurus OX=9913 GN=TRIM2 PE=2 SV=1
MASEATNIPS*10PVVRQIDKQFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSC
PVCRQTSILPEKGVAALQNNFFITNLMDVLQRSPGSSAEESSILETVTAVAAGKPLSCPN
HDGNVMDFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASLQVQLDAANRRLPEID
SALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQ
LDTLLEGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLD
FIVETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTIIGQPMSVTITTKDKDGELCKT
GNAYLTAELST*371PDGS*375VADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLK
VIRS*424ADVS*428PTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKG
RNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA
VHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVF
IFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIVTDFHNHSVKVFNQEGEFMLKFG
SNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLA
LTSDGHVVVADSGNHCFKVYRYLQ
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | TRIM2 is phosphorylated by the p42/p44 mitogen-activated protein kinase (MAPK) pathway, it is usually bound to Bim. |
|---|
| Additional Comments | Mutations in this gene can cause early-onset axonal neuropathy. Alternative splicing results in multiple transcript variants. |
|---|
| Bibliography | 1.Pehlivan D, Coban Akdemir Z, Karaca E, Bayram Y, Jhangiani S, Yildiz EP, Muzny D, Uluc K, Gibbs RA; Baylor-Hopkins Center for Mendelian Genomics, Elcioglu N, Lupski JR, Harel T. Exome sequencing reveals homozygous TRIM2 mutation in a patient with early onset CMT and bilateral vocal cord paralysis. Hum Genet. 2015 Jun;134(6):671-3. doi: 10.1007/s00439-015-1548-3. Epub 2015 Apr 17. PMID: 25893792; PMCID: PMC4426057. 2.Qin Y, Ye J, Zhao F, Hu S, Wang S. TRIM2 regulates the development and metastasis of tumorous cells of osteosarcoma. Int J Oncol. 2018 Oct;53(4):1643-1656. doi: 10.3892/ijo.2018.4494. Epub 2018 Jul 20. PMID: 30066883. 3. Yin H, Zhu Q, Liu M, et al. GPER promotes tamoxifen-resistance in
ER þ breast cancer cells by reduced Bim proteins through MAPK/
Erk-TRIM2 signaling axis. Int J Oncol. 2017;51:1191–1198. |
|---|
