Primary Information |
|---|
| BoMiProt ID | Bomi10044 |
|---|
| Protein Name | Triggering receptor expressed on myeloid cells 1/CD_antigen: CD354 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q6QUN5 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_996853.1 |
|---|
| Aminoacid Length | 232 |
|---|
| Molecular Weight | 25381 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | TREM1 |
|---|
| Gene ID | 404547 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Protein Function | The triggering receptor expressed on myeloid cells 1 (TREM-1) is a receptor of the innate immune system, expressed mostly by myeloid cells and primarily associated with pro- inflammatory responses. |
|---|
| PTMs | Disulfide bond formation,N-linked Glycosylation at Asn |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q6QUN5|TREM1_BOVIN Triggering receptor expressed on myeloid cells 1 OS=Bos taurus OX=9913 GN=TREM1 PE=2 SV=1
MRKAGVWGLLWMLFIEEIQAAAEVFEEKCTLAEGQTLKVSCPTNTNIYSNSQKAWQRLKD
NGEVQTLAITEGSSQVRVGKYFLEDIPSEGMLQIQMANLQVEDSGLYRCVILGPSDPIIL
FHPVRLVVTKNSLGTPASDEYPCQVSVQNPTPLPVTTKLRPRPRPRPKPVTQPIPTSADR
LSSPGFTVTPTN*192VTHVNRAPGISIIIPAACGLLSKTLVFIGLFAVTHRSFAS
|
|---|
| Predicted Disorder Regions | 133-188 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 1TMH; (204-226) |
|---|
| Additional Comments | TREM-1 blockade may be a therapeutic possibility in certain inflammation-producing bacterial infections while potentially deleterious in others. |
|---|
| Bibliography | 1.de Oliveira Matos A, Dos Santos Dantas PH, Figueira Marques Silva-Sales M, Sales-Campos H. The role of the triggering receptor expressed on myeloid cells-1 (TREM-1) in non-bacterial infections. Crit Rev Microbiol. 2020 May;46(3):237-252. doi: 10.1080/1040841X.2020.1751060. Epub 2020 Apr 24. PMID: 32326783. 2.Gallop D, Scanlon KM, Ardanuy J, Sigalov AB, Carbonetti NH, Skerry C. Triggering Receptor Expressed on Myeloid Cells-1 (TREM-1) Contributes to Bordetella pertussis Inflammatory Pathology. Infect Immun. 2021 Sep 16;89(10):e0012621. doi: 10.1128/IAI.00126-21. Epub 2021 Jun 7. PMID: 34097504; PMCID: PMC8445185. |
|---|
