Primary Information |
|---|
| BoMiProt ID | Bomi10004 |
|---|
| Protein Name | Transmembrane protein 184B |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A2VDL9 |
|---|
| Milk Fraction | Whey |
|---|
| Aminoacid Length | 407 |
|---|
| Molecular Weight | 45490 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | TMEM184B |
|---|
| Gene ID | 514220 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Protein Function | is critical for the maintenance of synaptic architecture.NMJ maintainenance |
|---|
| PTMs | phosphorylation on Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A2VDL9|T184B_BOVIN Transmembrane protein 184B OS=Bos taurus OX=9913 GN=TMEM184B PE=2 SV=1
MTVRGAALAPDPASPTTAAASPSISVIPEGSPTAMEQPVFLMTTAAQAISGFFVWTALLI
TCHQIYMHLRCYSCPNEQRYIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFGTVRDCYEA
LVIYNFLSLCYEYLGGESSIMSEIRGKPIESSCMYGTCCLWGKTYSIGFLRFCKQATLQF
CVVKPLMAVSTVVLQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATRELL
SPYSPVLKFFMVKSVIFLSFWQGMLLAILEKCGAIPKIHSARVSVGEGTVAAGYQDFIIC
VEMFFAALALRHAFTYKVYADKRVDAQGRCAPMKSISSSLKETMNPHDIVQDAIHNFSPA
YQQYTQQSTLEPGPTWRGGAHGLSRSHS*388LSGARDNEKTLLLS*402S*403DDEF
|
|---|
| Predicted Disorder Regions | 10-24, 326-332, 364-407 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 6TMHs; (38-60), (80-102), (117-135), (180-198), (210-232), (239-261) |
|---|
| Bibliography | Bhattacharya MR, Geisler S, Pittman SK, Doan RA, Weihl CC, Milbrandt J, DiAntonio A. TMEM184b Promotes Axon Degeneration and Neuromuscular Junction Maintenance. J Neurosci. 2016 Apr 27;36(17):4681-9. doi: 10.1523/JNEUROSCI.2893-15.2016. PMID: 27122027; PMCID: PMC4846669. |