Search by BoMiProt ID - Bomi9297


Primary Information

BoMiProt ID Bomi9297
Protein Name Solute carrier family 15 member 4/Peptide/histidine transporter 1
Organism Bos taurus
Uniprot IdA6QQL0
Milk FractionWhey
Ref Sequence Id NP_001095397.2
Aminoacid Length 566
Molecular Weight 61380
Fasta Sequence https://www.uniprot.org/uniprot/A6QQL0.fasta
Gene Name SLC15A4/PHT1
Gene Id 510499
Protein Existence Status reviewed

Secondary Information

Protein Function transmembrane protein consisting of 12 membrane-spanning regions and transports specific amino acids, oligopeptides, and carnosine coupled proton.responsible for transporting lipids, amino acids, sugars, neurotransmitters, and drugs across the biological membranes.essential in Toll-like receptor (TLR) stimulation and NOD2-NF-κB pathway activation in dendritic cells.
Biochemical Properties 12 membrane-spanning regions and transports certain types of amino acids, particularly histidine, and oligopeptides such as nucleotide oligomerization domain-1 (NOD1) ligand, L-Ala-γ-D-Glu-meso-diaminopimelic Acid (tri-DAP), and carnosine, together with a proton.Its transporter activity is pH-dependent maximized in the acidic lysosomal environment.
PTMs Phosphorylation on Ser
Linking IDs Bomi9297
Bibliography 1.Kobayashi T, Shimabukuro-Demoto S, Yoshida-Sugitani R, Furuyama-Tanaka K, Karyu H, Sugiura Y, Shimizu Y, Hosaka T, Goto M, Kato N, Okamura T, Suematsu M, Yokoyama S, Toyama-Sorimachi N. The histidine transporter SLC15A4 coordinates mTOR-dependent inflammatory responses and pathogenic antibody production. Immunity. 2014 Sep 18;41(3):375-388. doi: 10.1016/j.immuni.2014.08.011. PMID: 25238095. 2.Saikrithi P, Balasubramanian CP, Otta SK, Tomy S. Expression dynamics of solute carrier family 15 member 4 (SLC15A4) and its potential regulatory role in ovarian development of the Indian white shrimp, Penaeus indicus. Mol Biol Rep. 2020 May;47(5):3797-3805. doi: 10.1007/s11033-020-05471-x. Epub 2020 May 3. PMID: 32363413.
Protein Function transmembrane protein consisting of 12 membrane-spanning regions and transports specific amino acids, oligopeptides, and carnosine coupled proton.responsible for transporting lipids, amino acids, sugars, neurotransmitters, and drugs across the biological membranes.essential in Toll-like receptor (TLR) stimulation and NOD2-NF-κB pathway activation in dendritic cells.
Biochemical Properties 12 membrane-spanning regions and transports certain types of amino acids, particularly histidine, and oligopeptides such as nucleotide oligomerization domain-1 (NOD1) ligand, L-Ala-γ-D-Glu-meso-diaminopimelic Acid (tri-DAP), and carnosine, together with a proton.Its transporter activity is pH-dependent maximized in the acidic lysosomal environment.
PTMs Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QQL0|S15A4_BOVIN Solute carrier family 15 member 4 OS=Bos taurus OX=9913 GN=SLC15A4 PE=2 SV=2 MEGAGDERAPLLGARRTAFAGRRAACAAVLLTELLERAAFYGVTANLVLFLNGTAFGWEG AEASQALLLFMGLTYLVSPFGGWLADARLGRARAILLSLALYLLGMLAFPLLAAPATRSA LCGAPGPTNVRNCSAPPCTDTPTRYCAPAVLSALALVGLGVGAVKANITPFGADQVKDRG PEATRRFFNWFYWSINLGAIVSLGGIAYIQQNVSFVTGYAIPAVCIGVAFVVFLCGQTFF ITKPPDGSAFTDMFRILVYSCRPQKRIREHSPSGEGIGVFQQSSKHSLFDS*291CKMSRGGPF PEDKVEDVKALVKIVPVFLALIPYWTVYFQMQTTYVLQSLHLKIPEISSITTNPHTFPAA WLTMFDAVLILLLIPLKDKLVDPILKRNGLLPSSLKRIAVGMFFVMCSAFAAGILESKRL DLVKEKTINQTIGNVVYYAADLPIWWQVPQYVLIGVSEIFASIAGLEFAYSAAPKSMQSA IMGLFFFFSGVGSFVGSGLLALVSLKAIGWMSSHTDFGNINGCYLNYYFFLLAAIQGATL LLFLIVSVKYDRQRSRANGTPASRRT
Predicted Disorder Regions 1-18, 559-566
DisProt Annotation
TM Helix Prediction 11TMHs; (38-60), (67-85), (94-112), (187-209), (213-235), (310-328), (358-376), (397-415), (448-470), (483-505), (524-546)
Linking IDs
Bibliography 1.Kobayashi T, Shimabukuro-Demoto S, Yoshida-Sugitani R, Furuyama-Tanaka K, Karyu H, Sugiura Y, Shimizu Y, Hosaka T, Goto M, Kato N, Okamura T, Suematsu M, Yokoyama S, Toyama-Sorimachi N. The histidine transporter SLC15A4 coordinates mTOR-dependent inflammatory responses and pathogenic antibody production. Immunity. 2014 Sep 18;41(3):375-388. doi: 10.1016/j.immuni.2014.08.011. PMID: 25238095. 2.Saikrithi P, Balasubramanian CP, Otta SK, Tomy S. Expression dynamics of solute carrier family 15 member 4 (SLC15A4) and its potential regulatory role in ovarian development of the Indian white shrimp, Penaeus indicus. Mol Biol Rep. 2020 May;47(5):3797-3805. doi: 10.1007/s11033-020-05471-x. Epub 2020 May 3. PMID: 32363413.