Search by BoMiProt ID - Bomi9280


Primary Information

BoMiProt ID Bomi9280
Protein Name Sodium/potassium/calcium exchanger 1(Retinal rod Na-Ca+K exchanger) or Solute carrier family 24 member 1
Organism Bos taurus
Uniprot IdQ28139
Milk FractionWhey
Ref Sequence Id NP_777080.1
Aminoacid Length 1216
Molecular Weight 131614
Fasta Sequence https://www.uniprot.org/uniprot/Q28139.fasta
Gene Name SLC24A1/NCKX1
Gene Id 282474
Protein Existence Status reviewed

Secondary Information

Protein Function component of the visual transduction cascade.Transports 1 Ca2+ and 1 K+ in exchange for 4 Na+.controlling the calcium concentration of outer segments during light and darkness.
Biochemical Properties The large, N-terminal hydrophilic domain is extracellular and immediately follows the N-terminal signal sequence, distinguishing this class of cationic exchangers from others that do not contain this large hydrophilic loop.
PTMs Glycosylation on Asn and Phosphorylation on Ser and Thr
Linking IDs Bomi9280
Bibliography McKiernan CJ, Friedlander M. The retinal rod Na(+)/Ca(2+),K(+) exchanger contains a noncleaved signal sequence required for translocation of the N terminus. J Biol Chem. 1999 Dec 31;274(53):38177-82. doi: 10.1074/jbc.274.53.38177. PMID: 10608890.
Protein Function component of the visual transduction cascade.Transports 1 Ca2+ and 1 K+ in exchange for 4 Na+.controlling the calcium concentration of outer segments during light and darkness.
Biochemical Properties The large, N-terminal hydrophilic domain is extracellular and immediately follows the N-terminal signal sequence, distinguishing this class of cationic exchangers from others that do not contain this large hydrophilic loop.
PTMs Glycosylation on Asn and Phosphorylation on Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q28139|NCKX1_BOVIN Sodium/potassium/calcium exchanger 1 OS=Bos taurus OX=9913 GN=SLC24A1 PE=1 SV=2 MGKLIRMGAQERRSLWPKRLHWSRPLFLLGMLIIGSTYQYLTSPQGLPTLWAAVSSQHPV KVASRDLSNKEMMMVSSETSKSSSEMEVEAWAPEATAGRDGTPPGIARKNTPSTPRGTAS ITPAIPNNYSPTPTGTGKVKEDTSATPSGVLNHYTQSRPMVNSYTRLTARGEVKSSRPTQ SRGKEEKYSPSPLGRMVNSYAPSTLMTMPRSHGITPRTTVKDREIMATKKMLATNPSKRL VEKTTPTPLKGITDNTPTFLLSDLETDTLTSPRNVVEKKTLTTPRRVDSN*290SSTNHQGLVG KNN*303LTTPQGMVLEHTAAVSEGQVTISTMTRSSPTETKASTDAWKVRNPLPRTSAPIIRIS SATFRGLLKNPSKAPSTPAAPRVRANPTIQVRHCLVVEPAPVAPTAPSPSWTTAVIPGIP SPSGQPDLYPKAEYPRDLFSVEERRQGWVVLHIFGMMYVFVALAIVCDEYFVPALGVITD KLQISEDVAGATFMAAGGSAPELFTSLIGVFISHSNVGIGTIVGSAVFNILFVIGTCALF SREILNLTWWPLFRDITFYIFDLMMLILFFLDSLIAWWESVLLLLAYAFYVFTMKWNQQL ELWVKEQLNKRPVAKVMALGDLSKPGDGTVVVDEQQDNKKLKLSSMLTRGSS*652SASLHNST IRSTIYQLMLHSLDPLGEARPSKDKEEETLIPEAKATPQAKAESKPEEEPAKLPEVT*717VTP APAPDVKGDQEEDPGSQGVGAEAENTGERTGGEAEAPAEGENGERSGGDAALGGESEGKA ENESEGDIPAERRGDDEDEGEIQAEGGEVKGDEDEGEIQAGEGGEVEGDEDEGEIQAGEG GEVEGDEDEGEIQAGEAGEVEGDEDEGEIQAGEGGEVEGDEDEGEIQAGEAGEVEGDEDE GEIQAGEGGEVKGDEGEIQAGEAGEVEGEDGEVEGGEDEGEIQAGEGGEGETGEQELNAE IQGEAKDDEEGVDGEGGGDGGDSEDEEEEDEEEEDEEEEEEEEEEEEEENEQPLSLEWPE TRRKQAIYLFLLPIVFPLWLTVPDVRRLEAKKFFVITFLGSILWIAMFSYLMVWWAHQVG ETIGISEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPLPWM LFSLINGLQPVAVSSNGLFCAIVLLFLMLLFVISSIALCKWRMNKILGFTMFLLYFVFLI ISVMLEDRIISCPVSV
Predicted Disorder Regions 3 disordered segments; (78-205), (256-376) , (715-1019)
DisProt Annotation
TM Helix Prediction 11TMHs; (20-42), (448-466), (518-540), (549-571), (574-592), (1025-1043), (1056-1074), ( 1089-1111), (1124-1142), (1157-1179), & (1186-1204)
Linking IDs
Bibliography McKiernan CJ, Friedlander M. The retinal rod Na(+)/Ca(2+),K(+) exchanger contains a noncleaved signal sequence required for translocation of the N terminus. J Biol Chem. 1999 Dec 31;274(53):38177-82. doi: 10.1074/jbc.274.53.38177. PMID: 10608890.