Search by BoMiProt ID - Bomi8029


Primary Information

BoMiProt ID Bomi8029
Protein Name Phytanoyl-CoA hydroxylase interacting protein-like
Organism Bos taurus
Uniprot IdQ32L96
Milk FractionExosomes
Ref Sequence Id NP_001073266.1
Aminoacid Length 376
Molecular Weight 42562
Fasta Sequence https://www.uniprot.org/uniprot/Q32L96.fasta
Gene Name PHYHIPL
Gene Id 780878
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells  hypothalamus
Protein Function PHYHIPL may play a vital role in cell metabolism.
PTMs N-Linked glycosylation at Asn, Phosphorylation at Ser
Linking IDs Bomi8029
Bibliography 1.Fu H, Ge B, Chen D, Wu Y, Luo Q, Li X, Zheng C, Tang Q. Phytanoyl-CoA 2-Hydroxylase-Interacting Protein-Like Gene Is a Therapeutic Target Gene for Glioblastoma Multiforme. Med Sci Monit. 2019 Apr 9;25:2583-2590. doi: 10.12659/MSM.913895. PMID: 30962415; PMCID: PMC6474294.
Presence in other biological fluids/tissue/cells  hypothalamus
Protein Function PHYHIPL may play a vital role in cell metabolism.
PTMs N-Linked glycosylation at Asn, Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32L96|PHIPL_BOVIN Phytanoyl-CoA hydroxylase interacting protein-like OS=Bos taurus OX=9913 GN=PHYHIPL PE=2 SV=2 MEVPRLDHALNS*12PTS*15PCEEVIKN*23LS*25LEAIQLCDRDGN*37KSQDSGIAEMEELPVPRNIKISN ITCDSFKISWEMDSKSKDRITHYFIDLNKKENKNSNKFKHKDVPTKLVAKAVPLPMTVRG HWFLSPRTEYTVAVQTASKQVDGDYVVSEWSEIIEFCTADYSKVHLTQLLEKAEVIAGRM LKFSVFYRNQHKEYFDYIREHHGNAMQPSVKDNSGSHGSPISGKLEGIFFSCSTEFNTGK PPQDSPYGRYRFEIAAEKLFNPNTNLYFGDFYCMYTAYHYVILVIAPVGSPGDEFCKQRL PQLNSQDNKFLTCREEDGMLVYHHAQDVILEVIYTDPVGLSLGTVAEITGHQLMSLSTAN AKKDPSCKTCNISVGR
Predicted Disorder Regions 1-17, 38-47, 95-104, 207-218, 359-370
DisProt Annotation
TM Helix Prediction No TM helices
Linking IDs
Bibliography 1.Fu H, Ge B, Chen D, Wu Y, Luo Q, Li X, Zheng C, Tang Q. Phytanoyl-CoA 2-Hydroxylase-Interacting Protein-Like Gene Is a Therapeutic Target Gene for Glioblastoma Multiforme. Med Sci Monit. 2019 Apr 9;25:2583-2590. doi: 10.12659/MSM.913895. PMID: 30962415; PMCID: PMC6474294.