Search by BoMiProt ID - Bomi7856


Primary Information

BoMiProt ID Bomi7856
Protein Name PDZ and LIM domain protein 7
Organism Bos taurus
Uniprot IdQ3SX40
Milk FractionWhey,MFGM
Ref Sequence Id NP_001106722.1
Aminoacid Length 424
Molecular Weight 46433
Fasta Sequence https://www.uniprot.org/uniprot/Q3SX40.fasta
Gene Name PDLIM7
Gene Id 533851
Protein Existence Status Reviewed

Secondary Information

PTMs Phosphorylation
Linking IDs Bomi7856
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SX40|PDLI7_BOVIN PDZ and LIM domain protein 7 OS=Bos taurus OX=9913 GN=PDLIM7 PE=2 SV=1 MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGG LTHIEAQNKIRACGERLS*78LSLSRAQPAQSKPQKVQT*96PDKQPLRPLVPDASKQRLMEDTED WRPRPGTGQSRSFRILAHLTGTEFMQDPDEEHLKKSSQVPRTEAPTPASATPQEPWPGPT TPSPTSRPPWAVDPAFAERYAPDKTSTVLTRHTQPATPTPMQNRTSIVQAAAGGGHGGGG GSNGKTPVCHQCHKVIRGRYLVALGRAYHPEEFVCSQCGKVLEEGGFFEEKGAIFCPPCY DVRYAPSCAKCKKKITGEVMHALKTTWHVHCFTCAACKAPIRNRAFYMEEGAPYCEPDYE KMFGTKCRGCDFKIDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKDKPLCKSHA FSHV
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Linking IDs