Search by BoMiProt ID - Bomi7127


Primary Information

BoMiProt ID Bomi7127
Protein Name Microtubule-associated protein 4/MAP-4/Microtubule-associated protein U/MAP-U
Organism Bos taurus
Uniprot IdP36225
Milk FractionWhey
Ref Sequence Id NP_776530.1
Aminoacid Length 1072
Molecular Weight 111915
Fasta Sequence https://www.uniprot.org/uniprot/P36225.fasta
Gene Name MAP4
Gene Id 281295
Protein Existence Status reviewed

Secondary Information

Protein Function Promotes microtubule assembly.
PTMs Acetylation, Isopeptide bond formation, Phosphorylation on Ser and Thr, Ubl conjugation
Significance of PTMs Phosphorylated at serine residues in K-X-G-S motifs by MAP/microtubule affinity-regulating kinase (MARK1 or MARK2), causing detachment from microtubules.Phosphorylation on Ser-734 negatively regulates MAP4 activity to promote microtubule assembly.In humans, the critical phosphorylation sites responsible for MAP4 detachment from MTs are S768, S787 and S696 (the corresponding sites in mice are predicted to be S737, S760 and S667). p38/MAPK activation could lead to MAP4 phosphorylation with MT disassembly in cardiomyocytes during hypoxia .
Linking IDs Bomi7127
Bibliography Zhang J, Li L, Zhang Q, Wang W, Zhang D, Jia J, Lv Y, Yuan H, Song H, Xiang F, Hu J, Huang Y. Microtubule-associated protein 4 phosphorylation regulates epidermal keratinocyte migration and proliferation. Int J Biol Sci. 2019 Jul 24;15(9):1962-1976. doi: 10.7150/ijbs.35440. PMID: 31523197; PMCID: PMC6743305.
Protein Function Promotes microtubule assembly.
PTMs Acetylation, Isopeptide bond formation, Phosphorylation on Ser and Thr, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P36225|MAP4_BOVIN Microtubule-associated protein 4 OS=Bos taurus OX=9913 GN=MAP4 PE=1 SV=1 MADLS*5LADALTEPS*14PEIEEEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGSS*60 ESKKKPCSDTSQVEGTPSSQAAVLANGDHGIERNDVTGFPSEFLEEKMAYQGYQNSQNWP ENTNFCFEPEHMVNPIQTDPFKMHHDDGLEDSLFFPSGTTNTSVFVEQNDPLKDTYGMLP CDTFAPAAVVPQGWSAEAPNLAHLESFTSPEAVPQPLQPTAEPAEKVEMASGEERAEALE MMMKLQAADMAPS*253REAEMVLAKDVVPATETGVALAKDMES*280PT*282KPDEALVKDVESSIESDM ALVKDVVLPVQTEETAVKDAILPTETDVSLDEDLALSTETEVSTAQDILLFKET*354ESIPPV TMDLASAEGTVPPTDQEMTPVKVAAS*386LSEIEAPLDEDIVSSTEIRSAKEIGLSS*414ET*416EVAL SREMGLPPETEAILDKDMAAPPETEVIVPVKDMAPSPGIETTLAKDVAPRQEIEVTLGKD TVSLPATEMALGRNVALPPET*501EVTLAKDVAQPPETEVNLANNAALAKFS*529EAEVVPVPVKD METAQTQEATSEDSQLKSLQDEGQSAVPLMTS*572PEAVVAMGQKHS*584LPTDEDS*591VLEELEQKK PSSQTSELPSETSGVAKPEEGPPTGSVSGNDITAPPNKELPPS*643PEKKTKPLATTQPAKT*660S TSKAKTQPT*670SLPKQTAPTTLGGSNKKPMSLASGSVPAAPPKRPAAATSRPSTLPSKDTKP KPVAEAKIPEKRVS*734PSKPASAPAVKPGSKSTQAVPKAPATATLASPGSTSRNLS*774TPLPKR PTAIKTEGKPAEIKKMATKS*800APADLSRPKSTTTSSVKKSTTVPGTAPPAGAPSRARPTAT PPRPSGTPPVDKKPTAAKPTSSAPRLGRVAANAS*874APDLKNVRSKVGS*887T*888ENIKHQPGGGRA KVEKKTEAAAPARKPEPNAVTKAAGPIGNAQKPPTGKVQIQNKKVDISKVSSKCGSKANI KHKPGGGDVKIESQKLNFKEKAQAKVGS*988LDNVGHLPAGGAVKTEGGGSEAPPCPGPPAGE ELAIPEAAPEAGAPASASGLSGHTTLAGGGDQREAQTLDS*1060QIQETS*1066KWLGLA
Predicted Disorder Regions 7-33, 58-69, 192-220, 250-267, 296-417, 454-619, 654-657, 709-753, 799-817, 855-903, 940-993, 1022-1068
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylated at serine residues in K-X-G-S motifs by MAP/microtubule affinity-regulating kinase (MARK1 or MARK2), causing detachment from microtubules.Phosphorylation on Ser-734 negatively regulates MAP4 activity to promote microtubule assembly.In humans, the critical phosphorylation sites responsible for MAP4 detachment from MTs are S768, S787 and S696 (the corresponding sites in mice are predicted to be S737, S760 and S667). p38/MAPK activation could lead to MAP4 phosphorylation with MT disassembly in cardiomyocytes during hypoxia .
Linking IDs
Bibliography Zhang J, Li L, Zhang Q, Wang W, Zhang D, Jia J, Lv Y, Yuan H, Song H, Xiang F, Hu J, Huang Y. Microtubule-associated protein 4 phosphorylation regulates epidermal keratinocyte migration and proliferation. Int J Biol Sci. 2019 Jul 24;15(9):1962-1976. doi: 10.7150/ijbs.35440. PMID: 31523197; PMCID: PMC6743305.