Search by BoMiProt ID - Bomi5920


Primary Information

BoMiProt ID Bomi5920
Protein Name GA-binding protein subunit beta-2
Organism Bos taurus
Uniprot IdQ0V8G2
Milk FractionWhey
Ref Sequence Id NP_001069710.1
Aminoacid Length 447
Molecular Weight 48475
Fasta Sequence https://www.uniprot.org/uniprot/Q0V8G2.fasta
Gene Name GABPB2
Gene Id 540818
Protein Existence Status reviewed

Secondary Information

Protein Function It may act as transcription factor.
Biochemical Properties It has the ability to interact with purine rich GA repeats.Heterotetramer of two alpha and two beta subunits. The C-terminal is necessary for the formation of a heterotetrameric GABP-alpha-2/beta-2 complex, and also facilitates homotypic dimerization.Interacts with ADGRB2.Contains nuclear localization sequence (NLS, aa 243–319) for nuclear entry.
PTMs Phosphorylation on Ser
Significance of PTMs Lats1 Binds to and Promotes the Phosphorylation of GABPb, Inhibiting the homodimerization and nuclear localization of GABPb.
Linking IDs Bomi5920
Bibliography 1.Wu H, Xiao Y, Zhang S, Ji S, Wei L, Fan F, Geng J, Tian J, Sun X, Qin F, Jin C, Lin J, Yin ZY, Zhang T, Luo L, Li Y, Song S, Lin SC, Deng X, Camargo F, Avruch J, Chen L, Zhou D. The Ets transcription factor GABP is a component of the hippo pathway essential for growth and antioxidant defense. Cell Rep. 2013 May 30;3(5):1663-77. doi: 10.1016/j.celrep.2013.04.020. Epub 2013 May 16. PMID: 23684612; PMCID: PMC3855275. 2.Bovine Genome Sequencing and Analysis Consortium, Elsik, C. G., Tellam, R. L., Worley, K. C., Gibbs, R. A., Muzny, D. M., Weinstock, G. M., Adelson, D. L., Eichler, E. E., Elnitski, L., Guigó, R., Hamernik, D. L., Kappes, S. M., Lewin, H. A., Lynn, D. J., Nicholas, F. W., Reymond, A., Rijnkels, M., Skow, L. C., Zdobnov, E. M., … Zhao, F. Q. (2009). The genome sequence of taurine cattle: a window to ruminant biology and evolution. Science (New York, N.Y.), 324(5926), 522–528. https://doi.org/10.1126/science.1169588
Protein Function It may act as transcription factor.
Biochemical Properties It has the ability to interact with purine rich GA repeats.Heterotetramer of two alpha and two beta subunits. The C-terminal is necessary for the formation of a heterotetrameric GABP-alpha-2/beta-2 complex, and also facilitates homotypic dimerization.Interacts with ADGRB2.Contains nuclear localization sequence (NLS, aa 243–319) for nuclear entry.
PTMs Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus OX=9913 GN=GABPB2 PE=2 SV=2 MSLVDLGKRLLEAARKGQDDEVRTLMANGAPFTTDWLGTSPLHLAAQYGHYSTAEVLLRA GVSRDARTKVDRTPLHMAAADGHAHIVELLVRNGADVNAKDMLKMTALHWATEHHHRDVV ELLIKYGADVHAFSKFDKSAFDIALEKNNAEILVILQEAMQNQVNANPERANPVTMATPF IFTSGEVVNLASLVSSASTKTTSGDPHASSTVHFSNSTTSVLATLAALAEASAPLSNSHR ATANSEEIIEGNS*253VDSSIQQVVGSGGQRVITIVTDGIPLGNIQTAIPAGGIGQPFIVTVQ DGQQVLTVPAGQVAEETVIEEEAEEAEKLPLTKKPRIEEMTNSVEESKEGTERELLQQRL QEANRRAQEYRHQLLKKEQEAEQYRLRLEAMARQQPNGVDFAMVEEVAEVDAVVVTEREM EERETEVTGAVGTAEPHTGVSMETVST
Predicted Disorder Regions (308-447)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Lats1 Binds to and Promotes the Phosphorylation of GABPb, Inhibiting the homodimerization and nuclear localization of GABPb.
Linking IDs
Bibliography 1.Wu H, Xiao Y, Zhang S, Ji S, Wei L, Fan F, Geng J, Tian J, Sun X, Qin F, Jin C, Lin J, Yin ZY, Zhang T, Luo L, Li Y, Song S, Lin SC, Deng X, Camargo F, Avruch J, Chen L, Zhou D. The Ets transcription factor GABP is a component of the hippo pathway essential for growth and antioxidant defense. Cell Rep. 2013 May 30;3(5):1663-77. doi: 10.1016/j.celrep.2013.04.020. Epub 2013 May 16. PMID: 23684612; PMCID: PMC3855275. 2.Bovine Genome Sequencing and Analysis Consortium, Elsik, C. G., Tellam, R. L., Worley, K. C., Gibbs, R. A., Muzny, D. M., Weinstock, G. M., Adelson, D. L., Eichler, E. E., Elnitski, L., Guigó, R., Hamernik, D. L., Kappes, S. M., Lewin, H. A., Lynn, D. J., Nicholas, F. W., Reymond, A., Rijnkels, M., Skow, L. C., Zdobnov, E. M., … Zhao, F. Q. (2009). The genome sequence of taurine cattle: a window to ruminant biology and evolution. Science (New York, N.Y.), 324(5926), 522–528. https://doi.org/10.1126/science.1169588