Search by BoMiProt ID - Bomi3721


Primary Information

BoMiProt ID Bomi3721
Protein Name Adhesion G protein-coupled receptor L3/Latrophilin-3
Organism Bos taurus
Uniprot IdO97827
Milk FractionWhey
Ref Sequence Id NP_851376.1
Aminoacid Length 1580
Molecular Weight 176051
Fasta Sequence https://www.uniprot.org/uniprot/O97827.fasta
Gene Name ADGRL3/LPH3/LPHN3
Gene Id 282651
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells Brain-specific distribution but low levels are also detected in lung and spleen.
Protein Function Take part in cell-cell interactions through their enormous extracellular N-terminal domain and intracellular signaling via their canonical heptahelical transmembrane domain.
Biochemical Properties GPCR is cleaved at the conserved GPCR autoproteolysis site (GPS), but the resulting N-terminal fragment (NTF) and C-terminal fragment (CTF) remain attached to each other and incorporate into the plasma membrane as a non-covalently bound unit.NTF acts to suppress the intrinsic activity of the CTF.The peptide segment immediately following the GPS is critical for enhanced signaling, suggesting that this peptide stretch (also known as the tethered agonist (TA), Stachel, or stalk peptide) acts as an internal agonist in a manner analogous to that of protease-activated GPCRs (PARs).
PTMs O-glycosylated (major) and N-glycosylated,proteolytic cleavage
Significance of PTMs Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit.
Linking IDs Bomi3721
Bibliography Mathiasen S, Palmisano T, Perry NA, Stoveken HM, Vizurraga A, McEwen DP, Okashah N, Langenhan T, Inoue A, Lambert NA, Tall GG, Javitch JA. G12/13 is activated by acute tethered agonist exposure in the adhesion GPCR ADGRL3. Nat Chem Biol. 2020 Dec;16(12):1343-1350. doi: 10.1038/s41589-020-0617-7. Epub 2020 Aug 10. Erratum in: Nat Chem Biol. 2020 Aug 17;: PMID: 32778842; PMCID: PMC7990041.
Presence in other biological fluids/tissue/cells Brain-specific distribution but low levels are also detected in lung and spleen.
Protein Function Take part in cell-cell interactions through their enormous extracellular N-terminal domain and intracellular signaling via their canonical heptahelical transmembrane domain.
Biochemical Properties GPCR is cleaved at the conserved GPCR autoproteolysis site (GPS), but the resulting N-terminal fragment (NTF) and C-terminal fragment (CTF) remain attached to each other and incorporate into the plasma membrane as a non-covalently bound unit.NTF acts to suppress the intrinsic activity of the CTF.The peptide segment immediately following the GPS is critical for enhanced signaling, suggesting that this peptide stretch (also known as the tethered agonist (TA), Stachel, or stalk peptide) acts as an internal agonist in a manner analogous to that of protease-activated GPCRs (PARs).
PTMs O-glycosylated (major) and N-glycosylated,proteolytic cleavage
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|O97827|AGRL3_BOVIN Adhesion G protein-coupled receptor L3 OS=Bos taurus OX=9913 GN=ADGRL3 PE=2 SV=1 MWPSQLLVFMMLLAPIIHGGKHSERHPALASPLRHAERGPGGALPPRHLLQQPAAERATA HRGPGPRGATRGVRGPGAHGAQISAQAFSRAPIPMAVVRRELSCESYPIELRCPGTDVIM IESANYGRTDDKICDSDPAQMENIRCYLPDAYKIMSQRCNN*161RTQCAVVAGPDVFPDPCPG TYKYLEVQYECVPYKVEQKVFLCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYM PWTPYRTDTLTEYSSKDDFIAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFD LRTRIKSGEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNP YTLRIEGTWDTAYDKRSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKDSL VDVPFPNSYQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFGPLDSRSGQAHHGQVSYISPP IHLDSDLERPPVREISTTGPLGTGSTTTSTTLRTTTWSPGRSTTPSVSGRRN*532RSTSTPSP AIEVLNDITTHVPSASPQIPALEESCEAVEAREIMWFKTRQGQMAKQPCPAGTIGVSTYL CLAPDGIWDPQGPDLSN*617CSSPWVNHITQKLKSGETAANIARELAEQTRNHLNAGDITYSV RAMDQLVGLLDVQLRNLTPGGKDSAARSLNKLQKRERSCRAYVQAMVETVNNLLQPQALN AWRDLTTSDQLRAATMLLDTVEESAFVLADNLLKTDIVRENTDNIQLEVARLSTEGNLED LKFPENTGHGSTIQLSANTLKQNGRNGEIRVAFVLYNNLGPYLSTEN*827ASMKLGTEAMSTN*840 HSVIVNSPVITAAINKEFSNKVYLADPVVFTVKHIKQSEENFNPN*885CSFWSYSKRTMTGYW STQGCRLLTTN*911KTHTTCSCNHLTNFAVLMAHVEVKHSDAVHDLLLDVITWVGILLSLVCL LICIFTFCFFRGLQSDRNTIHKNLCISLFVAELLFLIGIN*1000RTDQPIACAVFAALLHFFFL AAFTWMFLEGVQLYIMLVEVFESEHSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVC WLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNINYEDNRPFI KSWVIGAIALLCLLGLTWAFGLMYIN*1166ESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRK EYGKCLRTHCCSGRSTESSIGSGKTSGSRTPGRYSTGSQSRIRRMWNDTVRKQS*1254ESSFIT GDINSSASLNRGAMANHLISNALLRPHGTNNPYNTLLGEPAVCNNPSVSMYNAQEGLLNN ARDTSVMDTLPLNGNHGNSYSIASGEYLSNCVQIIDRGYNHNETALEKKILKELTSNYIP SYLNNHERSSEQNRNLMNKLVNNLGSGSEDDAIVLDDATSFNHEESLGLELIHEESDAPL LPPRVYSTENHQLHHYTRRRIPQDHSESFFPLLTNEHTEDLQSPHRDSLYTSMPALAGVP TAESVTTSTQTEPPPAKCGDAEDVYYKSMPNLGSRNHVHQLHTYYQLGRGSSDGFIVPPN KDGTPPEGSSKGPAHLVTSL
Predicted Disorder Regions 523-527, 1222-1235, 1400-1420, 1464-1469, 1497-1522, 1564-1568
DisProt Annotation
TM Helix Prediction 6TMHs; (948-970), (1006-1028), (1051-1069), (1089-1111), (1143-1165), (1172-1194)
Significance of PTMs Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit.
Linking IDs
Bibliography Mathiasen S, Palmisano T, Perry NA, Stoveken HM, Vizurraga A, McEwen DP, Okashah N, Langenhan T, Inoue A, Lambert NA, Tall GG, Javitch JA. G12/13 is activated by acute tethered agonist exposure in the adhesion GPCR ADGRL3. Nat Chem Biol. 2020 Dec;16(12):1343-1350. doi: 10.1038/s41589-020-0617-7. Epub 2020 Aug 10. Erratum in: Nat Chem Biol. 2020 Aug 17;: PMID: 32778842; PMCID: PMC7990041.