Search by BoMiProt ID - Bomi3634


Primary Information

BoMiProt ID Bomi3634
Protein Name Active breakpoint cluster region-related protein
Organism Bos taurus
Uniprot IdA6QNS3
Milk FractionWhey
Ref Sequence Id NP_001039669.2
Aminoacid Length 859
Molecular Weight 97612
Fasta Sequence https://www.uniprot.org/uniprot/A6QNS3.fasta
Gene Name ABR
Gene Id 515556
Protein Existence Status reviewed

Secondary Information

Protein Function Regulates macrophage functions such as CSF1-directed motility and phagocytosis through the modulation of RAC1 activity.ABR mRNA is highly enriched in the brain.GTPase-activating proteins that increases GTPase activity of Rac1 and CDC42.
PTMs phosphorylation on Ser
Linking IDs Bomi3634
Bibliography Tan EC, Leung T, Manser E, Lim L. The human active breakpoint cluster region-related gene encodes a brain protein with homology to guanine nucleotide exchange proteins and GTPase-activating proteins. J Biol Chem. 1993 Dec 25;268(36):27291-8. PMID: 8262969.
Protein Function Regulates macrophage functions such as CSF1-directed motility and phagocytosis through the modulation of RAC1 activity.ABR mRNA is highly enriched in the brain.GTPase-activating proteins that increases GTPase activity of Rac1 and CDC42.
PTMs phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QNS3|ABR_BOVIN Active breakpoint cluster region-related protein OS=Bos taurus OX=9913 GN=ABR PE=2 SV=1 MEPLSHRGLPRLSWIDTLYSNFSYGADDYDAEGNEEQKGPPEGSETMPYIDESPTMS*57PQL SARSQGGGDSISPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPL KATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQ LGVYKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSRDSHTSVTMEALLYKPI DRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETR QLVKDGFLVEVSEGSRKLRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWYIPLADLVFPSP EESEASPQVHPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERLKKKMFENEFLLLL NSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCF KLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKT RVFRDTTEPKWDEEFEIELEGSQSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQLDP QTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQSGVFGVKISVVTKRERSKV PYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGT LKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLK RVAEKEPVNKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQH PPISFAELKRNTLYFSTDV
Predicted Disorder Regions 10-84, 633-641
DisProt Annotation
TM Helix Prediction No TM helices
Linking IDs
Bibliography Tan EC, Leung T, Manser E, Lim L. The human active breakpoint cluster region-related gene encodes a brain protein with homology to guanine nucleotide exchange proteins and GTPase-activating proteins. J Biol Chem. 1993 Dec 25;268(36):27291-8. PMID: 8262969.