Search by BoMiProt ID - Bomi9994


Primary Information

BoMiProt ID Bomi9994
Protein Name Transmembrane protein 115
Organism Bos taurus
Uniprot IdA4FUB8
Milk FractionWhey
Ref Sequence Id NP_001076930.1
Aminoacid Length 351
Molecular Weight 38139
Fasta Sequence https://www.uniprot.org/uniprot/A4FUB8.fasta
Gene Name TMEM115
Gene Id 532459
Protein Existence Status reviewed

Secondary Information

Protein Function Integral membrane protein,retrograde transport of proteins from the Golgi to the endoplasmic reticulum.
Biochemical Properties TMEM115 has four candidate transmembrane domains located in the N-terminal region. Both the N- and C-terminal domains are oriented towards the cytoplasm.contains a predicted coiled-coil domain
PTMs phosphorylation on Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A4FUB8|TM115_BOVIN Transmembrane protein 115 OS=Bos taurus OX=9913 GN=TMEM115 PE=2 SV=1 MQRALPGARQHLGAILSSASVVVKALCAAVLFLYLLSFAVDTGCLAVTPGYLFPPNFWIW TLATHGLMEQHVWDVAISLATVVVAGRLLEPLWGALELLIFFSVVNVSVGLLGAFAYLLT YMASFNLVYLFTVRIHGALGFLGGVLVALKQTMGDCVVLRVPQVRVSVVPMLLLGLLLLL RLATLLQSPALASYGFGLISSWVYLRFYQRHSRGRGDMADHFAFATFFPEILQPVVGLLA NLVHGLLVKVKICQKTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVED QSVWPSMDDDEEEAGAKVDSPMPSDKAPT*329LPGKGAVPESSLITFEAAPPTL
Predicted Disorder Regions 255-258, 270-284, 291-351
DisProt Annotation
TM Helix Prediction 7TMHs; ( 15-37), (44-62), (98-120), (127-149) ,(164-182), (189-207), (226-248)
Additional Comments TMEM115 knockdown or overexpression delays Brefeldin-A-induced Golgi-to-ER retrograde transport, phenocopying cells with mutations or silencing of the conserved oligomeric Golgi (COG) complex.  Knockdown of TMEM115 also reduces the binding of the lectins peanut agglutinin (PNA) and Helix pomatia agglutinin (HPA), suggesting an altered O-linked glycosylation profile.
Bibliography Ong YS, Tran TH, Gounko NV, Hong W. TMEM115 is an integral membrane protein of the Golgi complex involved in retrograde transport. J Cell Sci. 2014 Jul 1;127(Pt 13):2825-39. doi: 10.1242/jcs.136754. Epub 2014 May 7. PMID: 24806965; PMCID: PMC4077589.