Primary Information |
---|
BoMiProt ID | Bomi9994 |
---|
Protein Name | Transmembrane protein 115 |
---|
Organism | Bos taurus |
---|
Uniprot Id | A4FUB8 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_001076930.1 |
---|
Aminoacid Length | 351 |
---|
Molecular Weight | 38139 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/A4FUB8.fasta |
---|
Gene Name | TMEM115 |
---|
Gene Id | 532459 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | Integral membrane protein,retrograde transport of proteins from the Golgi to the endoplasmic reticulum. |
---|
Biochemical Properties | TMEM115 has four candidate transmembrane domains located in the N-terminal region. Both the N- and C-terminal domains are oriented towards the cytoplasm.contains a predicted coiled-coil domain |
---|
PTMs | phosphorylation on Thr |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A4FUB8|TM115_BOVIN Transmembrane protein 115 OS=Bos taurus OX=9913 GN=TMEM115 PE=2 SV=1
MQRALPGARQHLGAILSSASVVVKALCAAVLFLYLLSFAVDTGCLAVTPGYLFPPNFWIW
TLATHGLMEQHVWDVAISLATVVVAGRLLEPLWGALELLIFFSVVNVSVGLLGAFAYLLT
YMASFNLVYLFTVRIHGALGFLGGVLVALKQTMGDCVVLRVPQVRVSVVPMLLLGLLLLL
RLATLLQSPALASYGFGLISSWVYLRFYQRHSRGRGDMADHFAFATFFPEILQPVVGLLA
NLVHGLLVKVKICQKTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVED
QSVWPSMDDDEEEAGAKVDSPMPSDKAPT*329LPGKGAVPESSLITFEAAPPTL
|
---|
Predicted Disorder Regions | 255-258, 270-284, 291-351 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | 7TMHs; ( 15-37), (44-62), (98-120), (127-149) ,(164-182), (189-207), (226-248) |
---|
Additional Comments | TMEM115 knockdown or overexpression delays Brefeldin-A-induced Golgi-to-ER retrograde transport, phenocopying cells with mutations or silencing of the conserved oligomeric Golgi (COG) complex. Knockdown of TMEM115 also reduces the binding of the lectins peanut agglutinin (PNA) and Helix pomatia agglutinin (HPA), suggesting an altered O-linked glycosylation profile. |
---|
Bibliography | Ong YS, Tran TH, Gounko NV, Hong W. TMEM115 is an integral membrane protein of the Golgi complex involved in retrograde transport. J Cell Sci. 2014 Jul 1;127(Pt 13):2825-39. doi: 10.1242/jcs.136754. Epub 2014 May 7. PMID: 24806965; PMCID: PMC4077589. |