Search by BoMiProt ID - Bomi9991


Primary Information

BoMiProt ID Bomi9991
Protein Name Transmembrane protein 106B
Organism Bos taurus
Uniprot IdQ3ZC25
Milk FractionExosomes,MFGM
Ref Sequence Id NP_001029509.1
Aminoacid Length 275
Molecular Weight 31213
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZC25.fasta
Gene Name TMEM106B
Gene Id 508903
Protein Existence Status reviewed

Secondary Information

Protein Function Involved in dendrite morphogenesis and maintenance by regulating lysosomal trafficking via its interaction with MAP6.
PTMs Glycosylation, Lipidation, Myristoylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZC25|T106B_BOVIN Transmembrane protein 106B OS=Bos taurus OX=9913 GN=TMEM106B PE=2 SV=1 MGKSFSHLPLHSNKEDGYDGMTSTENIRNGLVNGEVHNEDGRSGDVSQFPYVEFTGRDSV TCPTCQGTGRIPRGQENQLVALIPYSDQRLRPRRTKLYVMASVFVCLLLSGLAVFFLFPR SIDVKYIGVKSAYVSYDVQKRTIYLN*146ITNTLN*152ITNNNYYSVEVEN*165ITAQVQFSKTVIGKA RLNN*184ITSIGPLDMKQIDYTVPTVIAEEMSYMFDFCTLLTIKVHNIVLMMQVTVTTTYFGH SEQISQERYQYVDCGRN*257TTYHLGQSEYLNVLQPQQ
Predicted Disorder Regions 1-50, 65-69
DisProt Annotation
TM Helix Prediction 1TMH; (97-119)