Search by BoMiProt ID - Bomi9981


Primary Information

BoMiProt ID Bomi9981
Protein Name Translocon-associated protein subunit gamma/Signal sequence receptor subunit gamma
Organism Bos taurus
Uniprot IdQ3SZ87
Milk FractionWhey
Ref Sequence Id NP_001070512.1
Aminoacid Length 185
Molecular Weight 21075
Fasta Sequence https://www.uniprot.org/uniprot/Q3SZ87.fasta
Gene Name SSR3
Gene Id 767980
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells caput epididymis 
Protein Function The translocon-associated protein (TRAP, also termed the signal sequence receptor) complex is required for the efficient translocation of secretory and membrane proteins in the endoplasmic reticulum, and is also involved in the endoplasmic reticulum stress-mediated unfolded protein response pathway.Trap-γ appears to be required for vascular network formation in murine placental development.
PTMs N-acetylation at Meth,Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SZ87|SSRG_BOVIN Translocon-associated protein subunit gamma OS=Bos taurus OX=9913 GN=SSR3 PE=2 SV=1 MAPKGGPKQQS*11EEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAV LYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLS*105EADNRKMSRKEKDER ILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFILKNFNPTVNYILSISASSGLIALL STGSK
Predicted Disorder Regions 1-14, 92-95, 102-113, 182-185
DisProt Annotation
TM Helix Prediction 4TMHs; (30-48),(55-77),(135-157),(164-182)
Bibliography 1.Yamaguchi YL, Tanaka SS, Oshima N, Kiyonari H, Asashima M, Nishinakamura R. Translocon-associated protein subunit Trap-γ/Ssr3 is required for vascular network formation in the mouse placenta. Dev Dyn. 2011 Feb;240(2):394-403. doi: 10.1002/dvdy.22528. Epub 2011 Jan 11. PMID: 21246656.