Primary Information |
|---|
| BoMiProt ID | Bomi9981 |
|---|
| Protein Name | Translocon-associated protein subunit gamma/Signal sequence receptor subunit gamma |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3SZ87 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001070512.1 |
|---|
| Aminoacid Length | 185 |
|---|
| Molecular Weight | 21075 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | SSR3 |
|---|
| Gene ID | 767980 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | caput epididymis |
|---|
| Protein Function | The translocon-associated protein (TRAP, also termed the signal sequence receptor) complex is required for the efficient translocation of secretory and membrane proteins in the endoplasmic reticulum, and is also involved in the endoplasmic reticulum stress-mediated unfolded protein response pathway.Trap-γ appears to be required for vascular network formation in murine placental development. |
|---|
| PTMs | N-acetylation at Meth,Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3SZ87|SSRG_BOVIN Translocon-associated protein subunit gamma OS=Bos taurus OX=9913 GN=SSR3 PE=2 SV=1
MAPKGGPKQQS*11EEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAV
LYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLS*105EADNRKMSRKEKDER
ILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFILKNFNPTVNYILSISASSGLIALL
STGSK
|
|---|
| Predicted Disorder Regions | 1-14, 92-95, 102-113, 182-185 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 4TMHs; (30-48),(55-77),(135-157),(164-182) |
|---|
| Bibliography | 1.Yamaguchi YL, Tanaka SS, Oshima N, Kiyonari H, Asashima M, Nishinakamura R. Translocon-associated protein subunit Trap-γ/Ssr3 is required for vascular network formation in the mouse placenta. Dev Dyn. 2011 Feb;240(2):394-403. doi: 10.1002/dvdy.22528. Epub 2011 Jan 11. PMID: 21246656. |
|---|
