Search by BoMiProt ID - Bomi9977


Primary Information

BoMiProt ID Bomi9977
Protein Name Translation initiation factor eIF-2B subunit delta/eIF-2B GDP-GTP exchange factor subunit delta
Organism Bos taurus
Uniprot IdQ3T058
Milk FractionWhey
Ref Sequence Id NP_001029716.1
Aminoacid Length 524
Molecular Weight 57469
Fasta Sequence https://www.uniprot.org/uniprot/Q3T058.fasta
Gene Name EIF2B4
Gene Id 521926
Protein Existence Status reviewed

Secondary Information

Protein Function necessary for protein synthesis.Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3T058|EI2BD_BOVIN Translation initiation factor eIF-2B subunit delta OS=Bos taurus OX=9913 GN=EIF2B4 PE=2 SV=1 MATAAVAVREDS*12GSGMKAELAPRPGAEGREMTQEEKLQLRKEKKQQKKKRKEEKGTETET GSAVSAAQCQVGPAKHLAGPDSQLGT*86AKEKVPAGRSKAELRAERRAKQEAERAMKQARKG DQGGPPPQACPSTAGETPSGVKRLPEHSQVDDPTLLRRLVKKPERQQVPTRKDYGSKVSL FSHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQD YTTPPSEELSRDLVNKLKPYFSFLTQCRPLSASMYNAIKLLNKEITGVSGSKREEEAKSE LRAAIDRYIKEKIVLAAQAISRFAYKKISNGDVILVYGCSSLVSHILQEAWAKGRQFRVV VVDSRPRLEAKHTLRSLVRAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVG TAQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLLCERGEHVALANWQNH SSLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
Predicted Disorder Regions 10-152, 166-170
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Kashiwagi K, Takahashi M, Nishimoto M, Hiyama TB, Higo T, Umehara T, Sakamoto K, Ito T, Yokoyama S. Crystal structure of eukaryotic translation initiation factor 2B. Nature. 2016 Mar 3;531(7592):122-5. doi: 10.1038/nature16991. Epub 2016 Feb 22. PMID: 26901872.