Search by BoMiProt ID - Bomi9961


Primary Information

BoMiProt ID Bomi9961
Protein Name Transforming growth factor beta activator LRRC33/Leucine-rich repeat-containing protein 33/Negative regulator of reactive oxygen species
Organism Bos taurus
Uniprot IdQ3ZBI5
Milk FractionWhey
Ref Sequence Id NP_001029563.1
Aminoacid Length 692
Molecular Weight 76520
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZBI5.fasta
Gene Name NRROS/LRRC33
Gene Id 510688
Protein Existence Status reviewed

Secondary Information

Protein Function acts as a negative physiological regulator for multiple Toll-like receptors.LRRC33 plays a critical role in maintaining immune homeostasis.
Biochemical Properties LRRC33 is a physiological regulator of multiple TLR-mediated activities, which is conferred by affecting the recruitment of adaptive molecules in TLR signaling by the interaction between the extracellular domain of LRRC33 and other TLRs
PTMs N-linked Glycosylation at Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZBI5|LRC33_BOVIN Transforming growth factor beta activator LRRC33 OS=Bos taurus OX=9913 GN=NRROS PE=2 SV=1 MELLPLWLCLGFHFLTVEWRHRSGMVTAASQGGCELLDGVADCRGRNLASVPSDLPPSSR TLLLDANPLRTLGN*74NSLQRYPFLESLSLHDCYLERIGHVAFQEQARLRSLALPDNALSES YKETAAALHGLRGLRMLDLSGNSLTEDMAALMLQN*155LSSLESVSLARNIIMRLDESVFEGL GHLRELDLQRNYIFEIEGGAFDGLTQLRHLNLAYNNLPCLVDFSLTQLRSLN*232VSYNVLEW FLASGGEAAFELETLDLSHNQLLFFPLLPQCSKLHTLLLRDNNMGFYRDLYN*292TSSPQEMV AQFLLVDGN*309VTN*312ITTVNLWEEFASSDLSSLRFLDMSQNQFQYLPDGFLKKMPSLSHLNLK QNCLVTLHIREHEPPGALVELDLSQNQLSELHLAPGLPGCLRSLQSFN*408LSSNQLLGVPAG LFANARNLATVDMSHNQISLCPLPASLDPGGTPGCVDFRNVASLQSLSLEDCGLEALQDC SFQGTALTHLDLSGNWGVLN*500GSIAPLWDVAPTLQVLSLRNVGLTSSFTELDFSAFENLRS LDLSGNALTSFPRFGGSLALQTLDLRRNLLTALPQRAVSEQLAGSLRTIYLSQNPYDCCG VEDWGALQRLHIVADLAMVTCN*622LSSKVIRLTELPAGVPQVCKWERVDMGLLYLVLILPSC LTLLVACTITFLTFRKPLLQVIKSRCHWSSIY
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 1TMH; (652-674)
Additional Comments LRRC33 is known as the Negative Regulator of Reactive Oxygen Species (NRROS), and its function is down-regulating of reactive oxygen species.
Bibliography 1.Ma W, Qin Y, Chapuy B, Lu C. LRRC33 is a novel binding and potential regulating protein of TGF-β1 function in human acute myeloid leukemia cells. PLoS One. 2019 Oct 10;14(10):e0213482. doi: 10.1371/journal.pone.0213482. PMID: 31600200; PMCID: PMC6786621. 2.Su X, Mei S, Liang X, Wang S, Liu J, Zhang Y, Bao Y, Chen Y, Che Y, Chunhua Zhao R, Zhang Z, Yang R. Epigenetically modulated LRRC33 acts as a negative physiological regulator for multiple Toll-like receptors. J Leukoc Biol. 2014 Jul;96(1):17-26. doi: 10.1189/jlb.0813457. Epub 2014 Feb 18. PMID: 24550525. 3. Liu, J., Zhang, Z., Chai, L., Che, Y., Min, S., Yang, R. (2013) Identification and characterization of a unique leucine-rich repeat protein (LRRC33) that inhibits Toll-like receptor-mediated NF-B activation. Biochem. Biophys. Res. Commun. 434, 28–34.