Search by BoMiProt ID - Bomi9960


Primary Information

BoMiProt ID Bomi9960
Protein Name Transformer-2 protein homolog beta/TRA-2 beta
Organism Bos taurus
Uniprot IdQ3ZBT6
Milk Fractionwhey
Ref Sequence Id NP_001029948.1
Aminoacid Length 288
Molecular Weight 33666
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZBT6.fasta
Gene Name TRA2B/SFRS10
Gene Id 615156
Protein Existence Status Reviewed

Secondary Information

Protein Function It can either activate or suppress exon inclusion. It acts along with RBMX to promote exon 7 inclusion of the survival motor neuron SMN2. It also activates the splicing of MAPT/Tau exon 10.
Biochemical Properties Binds to the AG-rich SE2 domain in the SMN exon 7 RNA
PTMs Acetylation, Methykation, Phsophorylation and Ubiquitinylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZBT6|TRA2B_BOVIN Transformer-2 protein homolog beta OS=Bos taurus OX=9913 GN=TRA2B PE=2 SV=1 MS*2DS*4GEQNYGERES*14RSASRSGSAHGSGKS*29ARHT*33PARSRSKEDSRRSRSKSRSRSESRSRS RRSSRRHYTRSRSRSRSHRRSRS*83RS*85YS*87RDYRRRHS*95HS*97HS*99PMST*103RRRHVGNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERAN GMELDGRRIRVDFSITKRPHT*201PT*203PGIYMGRPTYGS*215SRRRDYYDRGYDRGYDDRDYYS*237RSYRGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRSRSYSPRRY
Predicted Disorder Regions (1-114), (197-223), (262-288)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylated in the RS domains.Phosphorylation of Tra2b increases its interaction with the putative spermatogenic splicing factor RBM and also affects its localization and function.Tra2b also appears to be relatively hypo-phosphorylated in testis.Tra2b up-regulation in testis appears to be solely responsible for HipK3-T exon inclusion.Phosphorylation of Tra2b inhibits alternative splicing and binding of its own message.
Bibliography 1.Venables JP, Bourgeois CF, Dalgliesh C, Kister L, Stevenin J, Elliott DJ. Up-regulation of the ubiquitous alternative splicing factor Tra2beta causes inclusion of a germ cell-specific exon. Hum Mol Genet. 2005 Aug 15;14(16):2289-303. doi: 10.1093/hmg/ddi233. Epub 2005 Jul 6. PMID: 16000324. 2.Paudel, D., Ouyang, Y., Huang, Q., Zhou, W., Wang, J., Poorekhorsandi, M. E., Dhakal, B., & Tong, X. (2019). Expression of TRA2B in endometrial carcinoma and its regulatory roles in endometrial carcinoma cells. Oncology letters, 18(3), 2455–2463. https://doi.org/10.3892/ol.2019.10553