Primary Information |
---|
BoMiProt ID | Bomi9960 |
---|
Protein Name | Transformer-2 protein homolog beta/TRA-2 beta |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q3ZBT6 |
---|
Milk Fraction | whey |
---|
Ref Sequence Id | NP_001029948.1 |
---|
Aminoacid Length | 288 |
---|
Molecular Weight | 33666 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q3ZBT6.fasta |
---|
Gene Name | TRA2B/SFRS10 |
---|
Gene Id | 615156 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Protein Function | It can either activate or suppress exon inclusion. It acts along with RBMX to promote exon 7 inclusion of the survival motor neuron SMN2. It also activates the splicing of MAPT/Tau exon 10. |
---|
Biochemical Properties | Binds to the AG-rich SE2 domain in the SMN exon 7 RNA |
---|
PTMs | Acetylation, Methykation, Phsophorylation and Ubiquitinylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3ZBT6|TRA2B_BOVIN Transformer-2 protein homolog beta OS=Bos taurus OX=9913 GN=TRA2B PE=2 SV=1
MS*2DS*4GEQNYGERES*14RSASRSGSAHGSGKS*29ARHT*33PARSRSKEDSRRSRSKSRSRSESRSRS
RRSSRRHYTRSRSRSRSHRRSRS*83RS*85YS*87RDYRRRHS*95HS*97HS*99PMST*103RRRHVGNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERAN
GMELDGRRIRVDFSITKRPHT*201PT*203PGIYMGRPTYGS*215SRRRDYYDRGYDRGYDDRDYYS*237RSYRGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRSRSYSPRRY
|
---|
Predicted Disorder Regions | (1-114), (197-223), (262-288) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | Phosphorylated in the RS domains.Phosphorylation of Tra2b increases its interaction with the putative spermatogenic splicing factor RBM and also affects its localization and function.Tra2b also appears to be relatively hypo-phosphorylated in testis.Tra2b up-regulation in testis appears to be solely
responsible for HipK3-T exon inclusion.Phosphorylation of Tra2b inhibits alternative splicing and binding of its own message. |
---|
Bibliography | 1.Venables JP, Bourgeois CF, Dalgliesh C, Kister L, Stevenin J, Elliott DJ. Up-regulation of the ubiquitous alternative splicing factor Tra2beta causes inclusion of a germ cell-specific exon. Hum Mol Genet. 2005 Aug 15;14(16):2289-303. doi: 10.1093/hmg/ddi233. Epub 2005 Jul 6. PMID: 16000324. 2.Paudel, D., Ouyang, Y., Huang, Q., Zhou, W., Wang, J., Poorekhorsandi, M. E., Dhakal, B., & Tong, X. (2019). Expression of TRA2B in endometrial carcinoma and its regulatory roles in endometrial carcinoma cells. Oncology letters, 18(3), 2455–2463. https://doi.org/10.3892/ol.2019.10553 |