Search by BoMiProt ID - Bomi9955


Primary Information

BoMiProt ID Bomi9955
Protein Name Transcriptional repressor NF-X1/Nuclear transcription factor, X box-binding protein 1
Organism Bos taurus
Uniprot IdA6QLA0
Milk FractionWhey
Ref Sequence Id NP_001095499.1
Aminoacid Length 1116
Molecular Weight 123581
Fasta Sequence https://www.uniprot.org/uniprot/A6QLA0.fasta
Gene Name NFX1
Gene Id 515680
Protein Existence Status reviewed

Secondary Information

Protein Function nuclear proteins with the ability to bind to X-box cis-elements.bound a conserved X-box motif of MHC class II genes and transcriptionally repressed gene expression. its two splice variants protein products (NFX1-91 and NFX1-123) that are expressed in epithelial cells.bind to DNA (NFX1-91) and RNA (NFX1-123), and they are involved in gene expression regulation through transcriptional repression, transcriptional activation, and post-transcriptional mRNA stabilization.
Biochemical Properties NFX1-91 and NFX1-123 are two splice variants.They share a common N-terminus and central domain, but they have unique C-termini.In the N-terminus, there is a PAM2 motif. This motif is necessary for proteins to bind to cytoplasmic poly(A) binding proteins. In the central domain, there is a PHD/RING domain that has an E3 ubiquitin ligase function. There are also six cysteine-rich zinc-like fingers, which are required for DNA binding and are conserved from the murine homolog.For NFX1-91, its C-terminus is short and is lysine-rich. For NFX1-123, its unique C-terminus includes two additional zinc-like fingers and an R3H domain.
PTMs Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QLA0|NFX1_BOVIN Transcriptional repressor NF-X1 OS=Bos taurus OX=9913 GN=NFX1 PE=2 SV=1 MAEAPPVSGAFKFNTDAAEFIPQERKNSGLYCGSQRRLDSNRIGRRNYSS*50PPPCHLSRQI SYDDISAVHQHSFYPSGSKPKS*82QQTSFQSSVTNKS*95LKNHGLQNQPWQKLRSEKQHIRVKR AQGLIDQTS*129DAPGLENVAKSESGTNLREHS*150PSESEKEIVGADPRGAKPKKATQFIYSYGR GPKVKGKLKSEWGHRMTPKPEEAGPENTKPAGVIHPDSSDASSRKVVADGARRGEQRRHP QKRSPWEVEGARPRPGRNPPKQEGQRHTNAGSRDNMASIPKDDLNERPAKSTCDSGNLAV VSRSSRRADPEKCAVRRQDPQVAS*324FPRGKQNHMLKNVETHTGSLIEQLTTEKYECMVCCE LVRVTAPVWSCQSCYHVFHLNCIKKWARSPASQADGQSGWRCPACQNVSAHVPNTYTCFC GKVKNPEWSRNEIPHSCGEVCRRKQPGQDCPHSCNLLCHPGPCPPCPAFMTKTCECGRTR HTVRCGQAVSVHCSNPCDNILNCGQHHCAELCHGGPCQPCRVILNQVCYCGSTSRDVLCG TDIGKSDGFGDFGCLKICGKDLKCGNHTCSQVCHPQPCQPCPRLPQLVRYCPCGQTPLSQ LLELGSSGRKTCMDPVPSCGKVCGKPLPCGSLDFIHTCEKLCHEGDCGPCSRTSVISCRC SFRTKELPCTSLKSEDATFMCDKRCNKKRLCGRHKCNEICCVDKEHKCPLICGRKLRCGL HRCEEPCHRGNCQTCWQASFDELTCHCGASVIYPPVPCGTRPPECTQTCARVHECDHPVY HSCHSEDKCPPCTFLTQKWCMGKHELRSNIPCHLVDISCGLPCGATLPCGMHKCQRLCHK GECLGDEICKQPCTTSRANCGHPCMAPCHLSLPCPVTTCKAKIELQCECGRRKEIMVCSE ASSTYQRIAAISMASKITDMQLGDSVEISKLITKKEIHQARLECDEECSALERKKRLAEA FHISDDSDPFNVRSSGSKFSDSLKEDARKDLRFVSDIEKEMEALVEAVNKGKSSKKSHCF PPMNRDHRRIIHDLAQVYGLESVSYDSEPKRNVVVTAVRGKSICPSTTLTGVLEKENQSR PPPPIAHHRQTDKNPGSSNLQKIAKEPVIDYFDVQD
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments NFX1-123 expression in keratinocytes mediated augmented activation of epithelial differentiation indirectly through Notch1.
Bibliography Chintala S, Katzenellenbogen RA. NFX1, Its Isoforms and Roles in Biology, Disease and Cancer. Biology (Basel). 2021 Mar 30;10(4):279. doi: 10.3390/biology10040279. PMID: 33808060; PMCID: PMC8067315.